KEGG   Notothenia coriiceps (black rockcod): 104941314Help
Entry
104941314         CDS       T04920                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00561  Glycerolipid metabolism
ncc01100  Metabolic pathways
Module
ncc_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    104941314 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ncc01002]
    104941314 (mgll)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104941314 (mgll)
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S33
   104941314 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH Esterase Lipase_3 Peptidase_S9 Abhydrolase_2 PGAP1 LIDHydrolase Abhydrolase_5 Ser_hydrolase Abhydrolase_3 Thioesterase DUF2048 DUF1057 DUF1350 PAF-AH_p_II DUF3726
Motif
Other DBs
NCBI-GeneID: 104941314
NCBI-ProteinID: XP_010764702
Position
Unknown
AA seq 301 aa AA seqDB search
MPEPGAAPRRSPQGVPYSDLQHLVNADGLHLFCRYWEPAGPPRALVYIAHGAGEHCGPYD
EIAQRLKELSMLAFAHDHVGHGQSEGERMNVKDFQVYIRDSLQHVDLMKSRHPGLPVFIV
GHSMGGAISILTACERPSEFSGVVLIAPMVQMNPDSATPFKVFMAKVLNHMVPSLTLGTI
DSKWVSRDMKQVEAYDADELNFHGGMRVSFAMQLMGAAARIEREIPSISWPFLLLHGDTD
KLCDIRGSKLMHENAASSDKKFKVFEGAYHALHHDLPEVSESTLKEVTGWITDRIPAVTS
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccgggagctgctccgcggcggagcccgcagggagtcccctacagcgacctg
cagcacctcgtcaacgccgacggactgcacctgttctgccgctactgggagcccgccggc
ccgccaagggctctggtgtatattgcccatggagctggggagcattgtgggccgtatgat
gagatcgcacaaagactgaaggaactgtccatgctggcgtttgcgcacgaccacgttggc
catggtcagagtgaaggagagaggatgaatgtcaaagacttccaggtatacatcagagac
tcgctgcagcacgttgacctgatgaaatcccgccacccgggcctgcccgtcttcatcgtc
ggtcactccatgggtggtgccatctccatcctgacggcctgtgagaggcccagtgaattc
tctggagtggttctgatcgctccgatggtccagatgaacccggactcggccacaccgttc
aaggtttttatggcaaaggtcctcaaccacatggtgcccagcctcactctgggcaccatc
gactccaaatgggtgtcacgcgacatgaagcaggtggaggcgtatgacgccgatgagctg
aacttccacgggggcatgcgggtgtcgttcgccatgcagctgatgggggcggcggcgcgc
atcgagagggagatcccctccatcagctggcccttcctgctcctgcacggcgacaccgac
aagctctgcgacatcagaggctccaagctgatgcacgagaacgccgcgagctccgacaag
aaattcaaggtcttcgagggggcctaccacgcccttcaccacgacctcccggaggtgtct
gagtccacgctgaaggaggtgaccggatggatcacagatcgcatcccagctgtgacatcg
ccgtaa

DBGET integrated database retrieval system