KEGG   Notothenia coriiceps (black rockcod): 104941578
Entry
104941578         CDS       T04920                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00230  Purine metabolism
ncc00240  Pyrimidine metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104941578
   00240 Pyrimidine metabolism
    104941578
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104941578
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Methyltransf_22
Other DBs
NCBI-GeneID: 104941578
NCBI-ProteinID: XP_010765000
UniProt: A0A6I9MU46
Position
Unknown
AA seq 327 aa
MSALYRSVVFNRVSKLNTCLIQVMRFGYNAPPPQWKTPDSLQRAGNTSRSQDTTNPKAMA
NISRKLSVSCSRCLSTSPESGANRVKRVSIEGNIAVGKSTFARLLQSACPDWEVVAEPVS
KWQNIESGASKGTDASPQTTVSNLLQMMYQDPERWSYTFQTFSCMTRLRTQLQPPPARLL
RSEGVPVQVYERSVYSDRYIFALNMFELDCINSTEWAVYQDWHSLLVEQFGHQVELEGII
YLRAPPTTCLERLHRRGRAEEKGVELDYLEKLHVQHERWLVEKSTETHFEKLKQIPVLQL
DASVEFKSDPVVQEEFITKIKNFFSAL
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtctgccctgtatcgaagcgttgtgttcaaccgtgtttccaagttaaacacatgtttg
atacaagtcatgagatttgggtataatgcgcctcctccacagtggaagacacccgacagc
ctccagagagctggaaacacaagcagatcacaggacacaactaaccccaaagctatggct
aatatttctagaaagctcagtgtttcttgttcaaggtgtctctctacttcacctgagagt
ggagctaatcgagtgaaaagagtttctatcgagggcaacattgctgttggaaagtccacc
tttgcaagactcttgcagtcggcctgtccggactgggaggttgtggcagaacccgtcagc
aagtggcagaacattgagagtggtgcatcgaaggggacagacgcctccccccagaccaca
gtcagcaacttgctgcagatgatgtaccaggaccctgagcgctggtcctacacctttcag
acgttttcctgtatgacccggctgaggacgcagctgcagcctcctcctgctcgcctgctg
cgctcagagggagtgccggtccaggtgtacgagcgctccgtctacagtgacagatacatc
tttgccctgaacatgtttgagctggactgcatcaactctacagagtgggctgtctatcag
gactggcactccctcctagtggaacagttcggacaccaggtggagctagagggcatcatc
tacctcagagccccaccaacgacatgtttggagcgcctgcaccgacgaggcagggcagag
gagaagggagtggaactggactatctggaaaagctacacgttcaacatgagaggtggctg
gttgaaaagagcactgaaacacattttgagaagttgaagcaaatacctgtgttacaactc
gatgccagtgtggagtttaagagtgacccagtcgtgcaggaggaatttataacaaagata
aagaacttcttcagtgctttatga

DBGET integrated database retrieval system