KEGG   Notothenia coriiceps (black rockcod): 104942617Help
Entry
104942617         CDS       T04920                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104942617
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ncc04812]
    104942617
   04147 Exosome [BR:ncc04147]
    104942617
Membrane trafficking [BR:ncc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    104942617
Cytoskeleton proteins [BR:ncc04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     104942617
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104942617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin APC_u14
Motif
Other DBs
NCBI-GeneID: 104942617
NCBI-ProteinID: XP_010766162
Position
Unknown
AA seq 170 aa AA seqDB search
MYLLCVSLTVENGEHCDFTILRNMLIRTNMQDLKDVTNNVHYENYRSRKLAAVTYNGMDN
NKNKGQLTKTETSDSMSPLAQMEEERRDHVSKMKKMEQEMEQVFEMKVKEKLMKLRDSEA
ELQRRHEQMKKNLELQHRELEEKRRQLEEEKNSWEAQQRILEQQKLDASR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtatctgctctgtgtgtccctcacagtggagaacggagagcactgtgacttcaccatc
ctccgaaatatgctcatccgcactaacatgcaggacctgaaggacgtgacgaacaatgtt
cactacgagaattaccgcagcaggaaactcgctgcagtcacgtataacggcatggacaac
aacaagaacaagggacagctcaccaagactgagacatctgacagcatgagtcctctggcc
cagatggaggaggagcggcgggaccacgtgtccaagatgaagaagatggaacaggagatg
gagcaggtctttgagatgaaggtgaaggagaagctgatgaagctccgagactccgaggcc
gagctccagaggcgtcacgagcagatgaaaaagaacctggagttgcagcaccgagagctg
gaggagaaacgccggcagctggaagaggagaagaacagctgggaggctcagcagaggatc
ctggagcagcagaaactcgacgcctccaggtaa

DBGET integrated database retrieval system