KEGG   Notothenia coriiceps (black rockcod): 104943174Help
Entry
104943174         CDS       T04920                                 

Definition
(RefSeq) exportin-5-like
  KO
K14289  exportin-5
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104943174
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ncc03016]
    104943174
   03036 Chromosome and associated proteins [BR:ncc03036]
    104943174
Transfer RNA biogenesis [BR:ncc03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    104943174
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     104943174
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 104943174
NCBI-ProteinID: XP_010766812
Position
Unknown
AA seq 640 aa AA seqDB search
LQLFKAVSFEVGQENKAPRSRAVKNVRRHACSSIIKICRDYPRVLLPCFDMFYNHVKKLC
SSQATLSQMESSLMESLVLISNEFKDFEKQKAFIDELMASVVADWTSEEMRHVLSNPAVY
LSFVGADQVVTEQNKDAYTSGLNRARLSFCLYAMMGVVKRARWPVDLEEAKAGGFVVGLT
PTGAPIYRNPCTAQFLAFLPNVLALIRTQNSLFTPENMARLSETFTRAHDVMDAEKNVVL
GLSQNLLDIYDTAVYKSNLERMQGFSSTLYDNCFHVLGSAGVSLQQDFYTIERLSEEIAG
SAFSSLDHVPDHRLRPMIRVFLRQLVLSCPQEYYNSLLCPLLGPLFAYMQQRLNVKWQLI
SQRTSVNGEDEEVVVCQESHVTQEMLEEQLVRLLTREVLDLLSVSCISKKGHEPAADKEE
IDEEDMMMDSAQTASPAQPTEELSELGKHLFKHENIYMNMLTLTFTSLSWKDTTNCHRTA
SMVCWTLLRQVIGGNLLPEAVTWFYTSVLRALQVHGQHEVCNSTLSQLAMLIYENLRARY
PELRVVMTQIPKISVEALDQYDHRLLDPNAQKVGDKKRKDHFRKLIEGTVGKALCQQFRK
EVHIRNLPSLYKSPKPDKDVLQNSEATGLEALFAPEKNTL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
ctacagctgtttaaagcagtctcatttgaggttggtcaggaaaataaggcacctcggtcc
cgagctgtaaagaacgtgagacgacacgcctgttcttcaatcatcaaaatatgcagagac
taccctagggtcctcttgccttgttttgacatgttttacaatcacgtaaagaagctgtgc
tcaagccaggccacgctctctcagatggaaagttctctaatggagtctctggtgctcatc
agtaacgagttcaaagactttgaaaagcagaaggcttttatagacgagctgatggcttca
gtggttgcagactggacctcggaggagatgaggcatgtgctgtcgaaccctgccgtgtac
ctgtcctttgtcggggccgatcaggttgtcactgagcagaataaagatgcatacacatca
ggccttaatagagcgcggctgagtttctgcttgtatgccatgatgggggtggtgaagcgt
gcgcgctggcctgtcgacctggaggaagccaaagctgggggctttgttgtgggcctcacc
cccacaggagctcccatctacagaaacccctgcactgcccaatttctggcctttctgccc
aacgtgctggctctaatcaggacccaaaacagtctgttcaccccggagaacatggctcgt
ctgagtgagaccttcaccagggcccatgatgtgatggacgcagagaaaaatgtggttctt
ggtctctctcagaaccttctggacatttatgacacggctgtgtataaaagcaacctggag
cgaatgcagggattctcgtccacgttgtatgacaactgcttccatgtcctgggaagcgca
ggtgtgtcccttcagcaggatttctacaccattgagaggctgagtgaagaaatagctggc
tctgctttttcgtccctggaccatgtgccggaccacagacttcgccctatgattcgggtg
tttctgaggcagttggtgctatcgtgtcctcaggagtactacaacagtctactgtgcccc
ctgctgggacctttgtttgcctacatgcagcagagactcaacgtcaagtggcaactcatc
agccagaggacctctgtcaatggtgaggatgaggaggtggtggtgtgtcaggagagccat
gtgacgcaggagatgttggaggagcagctggtccgcctgctcaccagggaggtgctggat
cttctctctgtgagctgcatatctaaaaaaggacatgaaccagcagcagataaagaggaa
atagatgaggaagacatgatgatggattcggcgcagacggcgtctcctgcccagcccaca
gaggagctgagcgagctgggaaaacacctgtttaaacacgagaacatctacatgaacatg
ttgaccctcacctttacttccctgtcgtggaaggacaccaccaactgtcaccgcactgct
tccatggtctgctggacacttctgcgccaggttattgggggtaatcttcttcctgaagca
gtcacatggttttataccagcgtccttagggcccttcaggttcacgggcaacatgaagtc
tgcaactctaccctctctcagctggccatgctcatctatgaaaacctgcgagctcgctat
ccagagctaagagtagtgatgacccagatcccaaaaatcagtgtggaggctctagaccag
tatgaccaccggctcttggaccctaatgcccagaaggttggagacaagaagaggaaagac
cacttcaggaagctcatcgaaggaaccgttgggaaagctctgtgccagcagttcaggaag
gaggttcatatccggaatcttccatcgctctataaaagcccgaagccggacaaggatgta
ctgcagaacagtgaagcaacaggcctggaagctctcttcgccccagagaagaataccctg
tag

DBGET integrated database retrieval system