KEGG   Notothenia coriiceps (black rockcod): 104943457Help
Entry
104943457         CDS       T04920                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04020  Calcium signaling pathway
ncc04270  Vascular smooth muscle contraction
ncc04371  Apelin signaling pathway
ncc04510  Focal adhesion
ncc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104943457
   04020 Calcium signaling pathway
    104943457
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104943457
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104943457
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104943457
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104943457
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     104943457
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104943457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase I-set Pkinase_Tyr Ig_3 ig Ig_2 V-set fn3 Ig_C17orf99 DUF11 Ig_6 C1-set Ig_4 C2-set Kinase-like Pkinase_fungal Egh16-like Kdo SusE FTA2
Motif
Other DBs
NCBI-GeneID: 104943457
NCBI-ProteinID: XP_010767161
Position
Unknown
AA seq 851 aa AA seqDB search
MDKDGGKPKTFVSTFKLSLKPQARTFCVEKQKESRLDASNRKITGTHKLGIPSATDSRLP
LIQALQTPHFKQPLSDCAVCEGSDATFQGVITGSQPLSVSWLHNGERLHSSKTSFQNGVS
SLSLTQCKPGDAGTYTCTAENTAGKQSSSAVLQVTETKEIPRTSNHELQSEVTFKVALPK
NTQLSSASKNGRQHREENKGPPVEFEDPPKQVEVRVGEQVRLHCEFRSSSVPVACCWIFN
KDKVVVRGSRKSIMSSETQSSVEISQACPEDKGSYTVVVRNRKGSAQHTISLSVMDRPDP
PASQPVVSQLSTQSLVLSWTGPSYDGGTAVLGYKVEVRNEGQDSPENWTEATSRCKNTTF
HVRSGLQPLGQYRFRVRAYNSAGVSEPSRESECVKMATAKEEKKDEPDSYVTVTIDTKHK
AKDHYNVHEQLGVGKFGQVFRLSHKETGQEVAGKFYRARTSKERMAARKEIEIMNHLHHP
KLAQCFAAYESRSEMVMVMEYIAGGELFERIVDENFEHTEPTSARYMQQILEGMQYVHKQ
KIVHLDIKPENIVCVDTAGTRIKIIDFGLSSELEEGKPLMVMHGTPEFVAPEVINYEPVG
LETDLWSIGVICYILLSGESPFQGNNDAETLALVTAANFEFDQESFEDISDQAKDFISSL
LKRDRRCRPSCTEALAHPWVASFTPLSPLPTKSLNKCKMRRFLAKRKWKKTGKAVLALQR
MSNLSNRPDSPGSSSEEPGWSQEAEEAIQSLDKQLQSEPRFQQTLKDTTLPKGATARLTC
LVNGYPLLEVKWLQNEKALCELGRVSMEQHEDGLCSLVLEDLELSDSGVYVCRAGNKLGE
AMCSAKLKVEM
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggataaggatgggggaaagccaaagacctttgtgtctactttcaagctgtccctgaag
cctcaagccaggactttctgtgtggagaaacagaaagagagtagactggatgccagtaac
aggaagataacaggaacccacaagctggggatcccatctgcaacagattccagacttcca
ctgatccaggcactccaaacgcctcacttcaaacaaccactcagcgactgtgcagtctgt
gaaggaagtgatgctacctttcaaggtgttatcacaggaagtcaacctctgagcgtttcc
tggctacacaatggtgagaggttgcactcaagtaaaacctccttccagaatggtgtttcc
agtctgtctctgactcagtgtaaacctggcgatgccgggacgtacacgtgcacagctgag
aatactgctgggaaacagtcaagcagtgctgtgttacaagtcacagaaacaaaggaaatc
cccagaacaagcaaccatgagctgcaaagtgaggtcacatttaaggttgcgttacccaag
aacacccaattgtcctcagcttctaaaaatggacgacagcacagagaagaaaacaaaggg
cctcctgtggagtttgaggaccccccaaagcaggtggaggttcgagtaggagagcaggtc
cgacttcactgtgagttcaggagcagctctgtccctgtggcctgctgttggattttcaac
aaagacaaggtggtagtaagagggtcaaggaagtctatcatgagcagtgagacacagagc
agtgtggagatctctcaggcctgcccagaggacaaaggctcgtacaccgtcgtagtgcga
aacagaaaaggctctgcccagcacaccatctccctcagtgtcatggaccgccctgaccct
ccggcctcacagcctgtggtgtcccagctgtccactcagtccctggtcctgtcctggacg
gggcccagctacgacgggggcacagcagtgttgggctacaaagtggaggtgagaaatgag
ggccaagacagccctgagaactggacagaagcaaccagccgttgtaaaaacacaaccttc
cacgtacgctctggcctgcagcctctgggtcagtaccgcttccgtgttagagcctacaac
tcagcgggggtcagcgaacctagcagggagtctgagtgtgtgaagatggcgactgcaaaa
gaagaaaaaaaggacgagcctgattcatacgtcacagtgaccattgacaccaaacacaag
gccaaggatcactacaatgtgcacgagcagctgggagttgggaagtttggccaggtgttt
cggctgtcccacaaagaaacaggtcaggaggttgctgggaagttttaccgagcccgaacc
tccaaagaaagaatggcagcacgcaaagagatcgagattatgaaccatcttcaccaccca
aaactggcccagtgcttcgctgcctatgaatcacggtctgagatggtcatggtcatggag
tatattgcaggcggggagctctttgaacgcatcgtggatgaaaactttgagcacacggag
cccaccagtgcccgctacatgcagcagatcctggagggcatgcagtacgttcacaagcag
aaaatcgtccacttggacatcaagccagagaacatcgtctgtgtggatacagctggcaca
cggatcaaaatcatcgactttggcttatctagtgaactggaggagggtaaacctctgatg
gtgatgcatggtaccccagagtttgtggcccctgaggtgatcaactatgagcctgtaggc
ctggagacggacttgtggagtatcggagtcatctgctacatcttgctcagtggagaatct
cccttccaggggaacaacgatgctgagactttggctcttgtgactgctgccaacttcgag
tttgaccaggagagttttgaggacatctctgatcaagctaaagactttatcagctccctg
ctgaagagggaccggagatgcaggccgtcatgtaccgaggccctcgcacacccctgggtg
gcctcttttactccactgagccccctacccaccaagtccctgaataagtgcaagatgaga
cgctttctggccaagcgcaaatggaagaaaactggcaaggctgttttggccctacagcgg
atgtctaatctctccaacaggccagactctcctggcagctcctcagaggagccaggatgg
agccaagaggcagaggaggccatccagtcgctggataagcagctgcagagtgagcctcgc
ttccagcagaccctgaaggacaccacccttcccaaaggagccacagctcggctcacatgc
cttgtcaatggctacccactgctggaggtgaagtggcttcagaatgagaaggcgctgtgt
gaattgggcagagtgagcatggagcagcatgaagacgggctctgctctctggttctggag
gatttggagctttctgactctggagtttatgtgtgcagggccggcaacaagctgggggaa
gcaatgtgctccgccaaactgaaagtggagatgtaa

DBGET integrated database retrieval system