KEGG   Notothenia coriiceps (black rockcod): 104943648Help
Entry
104943648         CDS       T04920                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-A-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ncc01002]
    104943648
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104943648
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S33
   104943648
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 104943648
NCBI-ProteinID: XP_010767403
Position
Unknown
AA seq 88 aa AA seqDB search
MEMIMISGCILVLPVFAFIYSFMFWPGSLLKAYNWYMRRRLGLVIRYCKSGSYRFCYSSR
GTPGGATPSLLLLHGFSASKDMWLPIVK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggagatgataatgatatcaggatgtattctggttctcccagtcttcgcgttcatctac
tccttcatgttctggcctggatccctccttaaagcttacaactggtacatgcgtcgcagg
ctggggctggtgatccggtactgtaagagtggaagttaccgcttctgttacagcagccgc
gggacgccggggggggccacgccatcgctgctgcttctgcacggcttctccgcctccaag
gacatgtggttgcccatcgtcaag

DBGET integrated database retrieval system