KEGG   Notothenia coriiceps (black rockcod): 104943945Help
Entry
104943945         CDS       T04920                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104943945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ncc03012]
    104943945
Translation factors [BR:ncc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    104943945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI Nup54 SRI
Motif
Other DBs
NCBI-GeneID: 104943945
NCBI-ProteinID: XP_010767718
Position
Unknown
AA seq 318 aa AA seqDB search
VLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSKVERLYHDIAQQAFKFCL
QYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELW
QEAFKAVEDIHGLFALSKKPPKPQLMANYYNKVSTVFWKSGNALFHACTLHRLYHLSREM
RKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQSPPT
RQSLINDMVRFNLLQYVVPEVKELYNWLEVDFHPLKLSGRMTKVLNWVRDQSEKESDLQH
YVPHLQGNTILRLLQQVR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
tgttctcctgagtgctgtgagtggagaggacactcaggatcgtaccgatcgcctgctgct
cactccttgggtgaagttcttgtgggagtcctaccgccagtgcttggacctgctgaggaa
caactccaaggtggagcgcctgtaccatgacatcgcccagcaagcattcaagttctgcct
acagtacacccgtaaagcagaatttcgcaagctgtgtgacaatctgcgtatgcatctggg
tcaaatccagcgccaccacaaccagagcacggccatcaacctgaacaacccagagagtca
gtccatgcacctggagactcgcctggtgcagctggacagtgccatcagcatggagctctg
gcaggaagcattcaaggctgttgaagacatccatggcctgtttgccctttccaagaagcc
tcccaagccccagttgatggccaactactacaacaaggtgtcgactgtgttctggaaatc
tggaaacgctctcttccacgcctgcaccctccaccggctctatcacctctcaagagagat
gcgtaagaatctgacccaagatgagatgcagaggatgtccaccagagtcctcctggccac
gctgtctatccccatcacccccgagcgcacagacattgctcggctgctggacatggatgg
catcattgttgaaaaacaacgccggctggccaccctcctgggcctgcagtctccaccaac
ccggcagagtctcatcaatgatatggtgagatttaacttgctgcagtatgttgtacccga
agtgaaagaactgtacaactggctcgaggtagactttcaccctctgaagctgagcggacg
aatgaccaaggtgctgaactgggtgagagaccagtctgagaaggagtctgatctgcagca
ctatgtccctcacctgcagggtaataccatcctgaggctcctgcaacaggtacg

DBGET integrated database retrieval system