KEGG   Notothenia coriiceps (black rockcod): 104944204Help
Entry
104944204         CDS       T04920                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104944204
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104944204
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ncc04812]
    104944204
   04147 Exosome [BR:ncc04147]
    104944204
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104944204
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104944204
Membrane trafficking [BR:ncc04131]
 Others
  Actin-binding proteins
   Others
    104944204
Cytoskeleton proteins [BR:ncc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     104944204
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104944204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 Pkinase V-set Pkinase_Tyr Pur_ac_phosph_N C2-set_2 Herpes_BLLF1 BiPBP_C Kdo Nucleoporin_FG Cytokin-bind Kinase-like
Motif
Other DBs
NCBI-GeneID: 104944204
NCBI-ProteinID: XP_010768010
Position
Unknown
AA seq 3866 aa AA seqDB search
MPRITDTTKHSISMKWTRPMYDGGSDVCGYVVEILEEGTEQWYRATAKALKTNEYVAAGL
ASNKRYRFRVAAINSKGTGEFSEPSAEVEPLERIEIPDLELSDDLKKTVCLRAGGTLRLV
VFVSGRPAPVISWRKTGVELQSRGHIENTESYTALTVEKVSRYDSGKYIVEAENPSGKKS
VVVLVKVYDTPGPPTSVNVKDYTKESVVITWDVPSMDGGAHVSNYIVEKREASMKSYKTV
TTECRKTLLRITGVEEGVHYFFRVLPENIYGVGEACETLEAVLVCEVPSVPLDLQLVDVN
KSSATLRWERPLRDGGSRINGFSIEACKVGSERWTAVASVKASASQHTVTALTENDQYLF
RVRATNSRGASEPMDTVTPVTIQDIKVMPKIDMTSIPQKIVYVHRGKPIELNLPVVAQPL
PVCSWSFSGEKLKDSLDRIKIDGSRLTVRDTTINDTGDYALEVKNALGKAREVIKVIILD
KPGVPVGPVRIEDVDGLSVTTSWDPPEKDGGANVTGYVVEQRDAHRPGWFTVSESVTRPC
YKFSRLSEGTEYVFRVAAMNRFGVGRFLQSEVVENKSPKTIPGAPSQPEVLDVTHEGMTL
TWFAPEDNGGSTIAGYIIERKEAQSERWMKISKNPVTMTRFRSSGLTEGQEYEHRVTAIN
SRGEGKPSEASEITVAMDPIDPPGAPLRPTVTDTTRSSVSLAWQPPEEEGGAAVTGYFIE
MQKVDQVEWTLCNTTPTKICEYTLTHMPQSAEYKFRVIACNPGGTGEAAEVPGVVKVQEM
LGYPDYELDAKYEEGYVVRQGGVIRLSVPIRGKPIPSCKWTKDGRDIAHRAMIVSNDDVT
ELVIKEAHKDDTGSYDLVLENKCGKKAVYIKVKVIGRPDVPEGPLEYDDIQVRSVRVSWR
PPSDDGGSDILGYVVERREVPKAAWCTVDSRVTETSLVVKGLKENVQYHFRISAENQFGI
SRCLKSEEAVTPKTPLCPPEPPSNPPEIMEVTKTTVALSWARPRDDGGSRVTGYYVERRE
VSTEKWVRHNKTHITTTMYNVSGLIPDAEYMFRVVAQNDIGKSEAGPPSESVVCKDPFDK
PSQPGEIDIISITKDCITIHWQRPELDGGKEILGYWIEFREAGESAWKKCTKERSKDRQF
TMGGLMEATEYEFRIFAENETGLSRPRRTPMGIKTKLSVGEAPALKELMEDVTTKLGESG
TLTCAIVGRPLPEIRWYRYGRELIQSRKYKMSSDGRNHSISVLTDEQEDEGVYTCRAVNE
AGEVETSGKLRLQAAPQFHPGFPLKEKYYAGAGTSLRLHVVYIGRPIPQIMWFYDKKPLT
TSASVIIENTESYTHLVVRNVQRKTNAGRYKVQLSNVYGTVDTSLRVEIQDKPCIPEGPL
VVEALLKSSMVISWKAPKDDGGSMITNYIVEKREAKEGEVWNLVSSSVSGTTCRVPNLIE
NAGYYFRVSAQNQYGVSESLEIQSVVIVKSPFEKPGIPQQPFIMSSTNDSCVVCWKPPSS
DGGAKVSSYYLEKREKKQNKWISVTSNKIQETSFEVKALIEGFEYEFRVKCENLGGESDW
SEISAPITPKSEQSPRAPAFREEIRDMTAKYKANATFVTKVVGHPKPLVKWYRSGKEIEA
DGTKIKAQEFKGGYFQLVIIAADECDATVYQVRATNSSGSISTTANLEVEVPAKIHLPKE
LQGMGAVNAARGDNVTIKIPISGKPEPAIIWQKGQEILSNSPYHQVITTRSFTSLVFQKG
MERKDTGYYILTAKNRFGTDKQTIEVNVADIPEPPKGLVVSEISRDSITLAWQPPANDGG
SDIIGYIVEKCPTTADRWIRAGQTTDCGINIINIFGKTKYQFRVIAENQFGLSAPCQPTE
PITTKEDKSVTRNYDEEVDETREVTKEEALVYKVKELTSKYVISEELARCQFGIVHRCTE
IATKKTFMAKFIKVKGTDRELVLREIEALNIARHKNVIYLHEYFESMEEIILIFEFISGV
DIFERLGTSSFELTEQEIVRYLRQVCSALKFMHSNNYAHFDIRPDNIIYTTKRSTTVKII
DMGQARLLVPGENIRALFSAPEYCAPEIHRHDLVTTATDMWSVGVMAYVLLSGLNPFAGE
SITKMIENISSCEYIFDSEAFKDISLEAMDFVDRLLVKDRKLRMTAHEALEHPWLKMKIE
NVSNKVIRTLKHRRYYQSLVKRTDTIVSSARVAYGGAFKNQRGYAVGKVKIGTEYHGLRT
GPVMHGSSEEGGHIRFTCSIVDYNKSTQVSWFFGNRQLHASNKYEITYSNGFASIYVKDI
EESDNGVYRCKVVSDDGEDSSYGELFVETVRSIREHYISRSIKKLRKRVDQAKLLQRPPE
FTLPLYNRSAYIGEDVRFGVTITVHPEPQVAWLKNGERIKPGEDDRKYTFTSDKGLYQLM
IHNVDASDDAEYTVMAHNKFGEDSCVARLTVTPHPVMEETMRPMFKRLLANVDCVEGNSV
RFELRVSGIPSPTLKWKKDGHAMEFGPKVVVIEEDVDYHVLHIRNTLLEDSAVYHVTATN
CAGSISCQATLKVDRLTYTRREYKSEEEKYMHVQKQIEKTNKMARKIVATEEMVALNPTA
QDALKFAAEMYKPAVGTKNVEGEFDITVQKSETKKLEEERRIFMPYEIPEPQIHDPKALD
EDKTIKQFVPLSDMKWYRKLRDQYVVPERMEKIVQKRQRRIRLSRWEQFYVVPLPRITDQ
YRPRWRIPKLSLDDLETVRPGRRSPSPESEASFRSRRRSLGDLSDEELLMPVDDYLSMRR
TEEEKTMLEDELELGFSASPSGSPVRMEVREERRHVVRHEAVEVTQTKKKRTVSQFMRRR
RSLSPTYIELMRPVSELIRPSRARTVEVQGEVVTRRSPTPERTRPRSPSPIRSAERSSRS
SSRFERTARFDIMSRYEARKTALKSERKYQVVSQTPFSLDHAPRVTVRMRSHRIPIGQDT
KFTLNIQSKPNAEVKWLHNGNEIFESSNKYVFTNMSGVLSIAILDCQAEDSGSYRCVCSN
SKGDASDYATLDVSGGGYTTFCSRRRDEEVIKGFVPEVTKIDHYHTTHFKAGYSAESHLQ
VEESKSKLTEKHEVTTRERYAASSERYSSAERYDSSIKFAAAEYLSSDSSYSSERFSLSA
QRTTSEAKVKSTSVGESVVHKVAPSLPARMLTKPQSVTVSEGESAKFTFDIDGEPAPTVT
WMHESRTIISSHHVQVTTTQYKSSFEISSVTISDEGSYTVVVENSAGRQEAHFTLTIRRP
APTEEVSAVKSPTPSVKSPEPSVTSPAPSATSPVPSIKSPEPSIKSPTPSVKSPEPSVTS
PVPSVKSPTPSVKSPEPRVTSPAPSVKSPTPSVKSPEPSVTSPAPSVKSPTPSVKSPEPS
VTSPTPSVKSPTPGVKSPEPEGVRSPRGVKSPEPRVKSPTQVKTPERVKSPEPEGVKSPF
GVKSPEPAGVKSPFGVKSPEPAGVKSRFGAKSPEPAGIKSPFGAKSPEPAGIKSPFGAKS
PEPAGIKSPFGAKSPEPAGIKSPRGLKSPEPSGIKSPRALKSPEPEGIKSPRVKSPPPIM
SPKRVASPPTVKSPVPKPPKVVSQVMAEASEGSVRMSCVCESSVREAVWFVNGRRLSQSS
HFEMHYSEGSCSLLIHDLADSDQGEYTCEMTSEGGVSKSSFSFTGQVFQSIRMKVTAYHE
QQVALKGSMAMSLKESSLSSVSSSMSSSMSSSMMMKKEMHAMQESSSFSSSSAQQAMMSS
MMESSSMGSMAAEMKFETMSMSSMSSLTSETYAMSSSSSMAEGSAFRAIGSAPRIEALPE
DISIEPGKVLTVTCAFSGDAKLIQWSRGGKNIEVTAGGRFHIDTTEDLTTLIITGVKEED
AGTYTLKLSNELGSDSATVHISIRSV
NT seq 11601 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcatcacggacaccacgaagcacagcatcagcatgaagtggacgcgcccgatg
tacgacggcggcagcgacgtctgcggctacgtggtggagatcctggaggaagggacggag
cagtggtaccgcgccaccgccaaggccctgaagaccaatgagtacgtggccgccggactc
gcctccaacaagaggtaccgcttcagagtcgccgccatcaacagcaagggaaccggagag
ttcagcgagcccagcgccgaggtggagccgctggagaggatcgagatcccagacctggag
ctgtcggacgacctgaagaagacggtgtgtctgcgtgccggtgggacgctgcgcctggtg
gtgttcgtcagcggccgccccgccccggtgatttcctggaggaagacgggggttgagctg
cagagccgtggacacatcgagaacacggaaagctacaccgccctgacggtggagaaggtc
agccgctacgactccgggaaatacatcgtggaggcggagaacccgtcgggaaagaagagc
gtcgtggtgctcgtcaaagtctacgacacgcccggcccccccacctctgtgaacgtgaag
gactacaccaaggagtcagtggtgatcacctgggacgttcccagcatggacggcggcgcc
cacgtcagcaactacatcgtggagaagcgcgaggccagcatgaagtcttacaagacggtg
accacggagtgcaggaaaacgctgctccgcatcaccggggtggaggagggcgtgcactac
ttcttcagagtgctgccggagaacatctacggcgtgggcgaggcctgcgagaccctggag
gcggtgctggtgtgcgaggtgccgtcggtgccgctcgacctgcagctggtggacgtcaac
aagtcgtcggccacgctgcgctgggagcggccgctgcgcgacggaggaagccgcatcaac
ggcttctccatcgaggcgtgcaaggtggggtcggagaggtggaccgcggtggcctccgtg
aaggcgtcggcgtctcagcacaccgtcaccgcgctcaccgagaacgaccagtacctgttc
agggtcagagccactaacagcaggggggccagcgagcccatggacaccgtcacccccgtc
accatccaggacatcaaggtgatgccaaagatcgacatgaccagcatcccgcagaagatc
gtgtacgttcaccgggggaaacccatcgagctgaacctgcccgtggtggcccagccgctg
cccgtctgctcctggtccttctccggagagaagctgaaggacagcctcgaccgcatcaag
atcgacggcagccggctgacggtgcgcgacacgaccatcaacgacaccggggactacgcc
ctggaggtgaagaacgccctgggcaaagccagagaggtcatcaaggtcatcatcctcgat
aagcccggcgtcccggtgggcccggtccggatcgaggacgtggacgggctgtcggtgacg
accagctgggatcctccggagaaagacggtggagccaacgtgacgggctacgtggtggag
cagcgcgacgcccaccggcccggctggttcaccgtgtccgagtccgtgacccggccctgc
tacaagttctcccgcctctccgagggaaccgagtacgtgttccgcgtcgccgccatgaac
cgcttcggagtcggaaggttcctgcagtcggaggtggtcgagaacaagagccccaagacg
atccccggcgcccccagccagccggaggtcctggatgtgacccacgagggcatgacgctc
acgtggttcgcccccgaggacaacggcggctccaccatcgccggatacatcatcgagcgt
aaggaggcgcagtcggagcgctggatgaagatcagcaagaacccggtcaccatgacccgg
ttccgctcctccgggctcaccgagggccaggagtacgagcaccgcgtcaccgccatcaac
tcccggggcgaggggaagcccagcgaggcctccgagatcaccgtggccatggaccccatc
gacccccctggagctcctctccgccccaccgtcacagacaccacccgctcctcggtgtct
ctggcctggcagccgccggaggaggagggcggtgccgccgtcaccgggtacttcatcgag
atgcagaaggtggaccaggtggagtggaccctgtgcaacaccacccccaccaagatctgc
gagtacaccctcactcacatgcctcagagcgccgagtacaagttcagagtcatcgcctgc
aaccctggaggaaccggggaggcagccgaggtgccgggggtggtgaaggtccaggagatg
ctgggctaccccgactacgagctggatgctaagtacgaggagggctacgtggtgcggcag
ggcggcgtcatccgcctgtccgtgcccatcagagggaaacccatcccgtcctgcaagtgg
acgaaggacggccgcgacatcgcccaccgcgccatgatcgtctccaacgacgacgtcacc
gagctggtgatcaaagaggcgcacaaagacgacacgggctcctacgacctggtgctggag
aacaagtgcggcaagaaggccgtctacatcaaggtgaaggtgattggccgccccgatgtt
cctgaaggtcctctggagtacgacgacatccaggtgcgctcagtgcgcgtcagctggagg
ccgccttcagacgacggaggatccgacatcctgggctacgtggtggagaggagggaggtg
ccgaaggccgcctggtgcaccgtggactcccgggtcaccgagacctctctggtggtgaag
ggtctgaaggagaacgtgcagtaccacttcaggatctctgcggagaaccagttcggcatc
agcaggtgtctgaagtccgaggaggccgtcacgcccaaaacacctctgtgcccaccagag
ccccccagcaaccccccggagatcatggaggtcaccaagaccacggtggccctgtcctgg
gctcggccgagggacgacggcggctccagagtcaccggctactacgtggagaggagggag
gtgtccacggagaagtgggtccgccacaacaagacccacatcaccaccaccatgtacaac
gtctccggactcatccccgacgcagagtacatgttcagggtggtcgcgcagaacgacatc
ggcaagagcgaggccggacccccctcggagtccgtggtctgcaaggatccattcgacaaa
cccagccagcccggtgagatcgacatcatctccatcaccaaagactgcatcaccatccac
tggcagcggcccgagctcgacggaggcaaagagatcctcggctactggatcgagttcagg
gaggccggagagagcgcctggaagaaatgcaccaaggagcgctccaaggaccggcagttc
accatgggcggcctgatggaggccaccgagtacgagttcaggatcttcgccgagaacgag
accggactcagccgaccccgccgcacacccatgggcatcaagaccaaactgagcgttggt
gaggctcccgctctgaaggaactgatggaagacgtcaccacgaagctcggggaatccggc
actctgacctgcgccatcgtcggccgcccgctgcccgagatcaggtggtaccgttacggc
agggagctgatccagagccgcaagtacaagatgagctcggacggcaggaaccactcaatt
agcgtcctgacagacgagcaggaggacgagggcgtttacacctgccgcgccgtcaacgag
gccggcgaggtcgagaccagcggaaagctgcgccttcaagcagcgccgcagttccacccc
ggcttccctctgaaggagaagtactacgccggcgcaggaaccagcctccgcctccacgtg
gtctacatcggacgtcccatccctcagatcatgtggttctatgacaagaagcctctgacc
acatcggcgagcgtgatcattgagaacacggagagctacacccacctggtggtgaggaac
gtgcagaggaagaccaacgccggccgctacaaggtgcagctcagcaacgtgtacggcaca
gtcgacacgtcgctgcgcgtggagatccaagataaaccatgcatccctgagggccctctg
gttgttgaagccctgctgaagagctccatggtcatcagctggaaggctcccaaggacgac
ggaggctccatgatcaccaactacatcgtggagaaacgtgaggccaaggaaggtgaggtg
tggaacctggtgtcctcctccgtctctggcaccacctgccgagtccccaacctgatagaa
aacgccggatactactttagagtctctgcgcagaaccagtatggagtcagcgagtctctg
gagatccaatctgtggtcatcgtcaagagtccatttgaaaaacctggcatcccacagcag
ccgttcatcatgagctccaccaacgactcctgcgtcgtctgctggaagcctccaagcagc
gacggcggcgctaaggtctccagctactacctggagaaacgcgagaagaaacagaataag
tggatatccgtcaccagcaacaagatccaggagaccagcttcgaggtcaaggccttgatc
gagggcttcgagtacgagttccgtgtcaagtgcgagaacttgggcggcgagagcgactgg
agcgagatctcagcgccaatcacccccaagtccgaacaatcccctcgcgctcccgccttc
agagaggagatccgggacatgacagccaaatacaaggccaatgccacattcgtcaccaag
gtggtgggacatcccaagcctctggtgaaatggtatcgcagtggaaaggagatcgaggct
gatggaacaaaaattaaagcccaggagttcaagggaggctacttccaactggtgatcatt
gccgctgatgagtgcgacgccaccgtttaccaagtcagagcaaccaactcctctggctcc
atctctaccaccgcaaacctggaggtggaagttcctgccaagatccaccttcccaaggag
ctccagggaatgggtgcagtcaatgctgcccgtggtgataatgtcaccatcaagatcccc
atctctggcaaacctgagccagcaatcatttggcagaagggtcaggagatcctgtccaac
tctccatatcaccaagtcatcaccaccaggtccttcacctcgctggtgttccagaaggga
atggagaggaaggataccggctactacatcctgaccgcaaagaacaggttcggaacagac
aagcaaaccattgaggtgaacgtggccgacatacctgaaccaccaaagggactggttgtc
agcgaaatctctcgagactccatcaccttggcctggcagccacctgcaaacgatggcgga
agcgacatcattgggtacattgtggagaagtgtcccacaaccgccgacaggtggatccgt
gccggacagaccaccgactgcggcatcaacatcattaacatattcggaaagaccaagtac
cagttcagagtcatcgccgagaaccagtttggcctgagtgctccttgccagccaacagag
cccatcaccacaaaggaagacaagtcagtgactaggaactatgatgaggaggtggacgag
accagagaggtcaccaaggaggaggctctggtctacaaggtgaaggagctgacctccaag
tacgtaatctctgaggaacttgcccgctgccagtttggaattgtccaccgctgcacggag
atcgccacaaagaagaccttcatggccaagttcatcaaggtgaagggaaccgaccgtgag
ttggtcctcagagaaattgaagctctcaacatagcaaggcacaagaacgtcatctacctg
catgaatactttgaaagcatggaggagatcatcctcatctttgaatttatttctggagtt
gacatctttgagcgccttggcaccagcagctttgagctgacagagcaggagatcgtccgc
tacctgagacaggtctgctctgccctcaagttcatgcatagcaacaactatgcacacttt
gatatccgcccagacaacatcatctacaccacaaagagaagcaccaccgtaaagattatt
gatatgggccaggctaggctgctggtgcctggtgaaaacatcagagcgctgttctcagct
ccggagtactgcgcccctgagatccaccgccacgacctggtcacaacggccactgatatg
tggtctgttggtgtgatggcctacgttttgctcagtggcctgaatccgtttgccggagag
tccattacaaagatgatcgagaacatctccagctgtgagtacatctttgatagcgaagca
ttcaaggacatcagtctggaggctatggactttgtggacagacttctagtcaaagacagg
aagctccgtatgacagcccacgaggctctggaacacccatggctcaagatgaagattgag
aatgtcagcaacaaggtcatcaggacattgaagcacagaaggtactatcagtctcttgtt
aagaggacagataccattgtatcatcagcccgtgtggcctatggtggcgctttcaagaac
cagagaggatatgctgttggtaaagtgaagatcggaaccgagtaccacggcctccgcacg
ggacccgtcatgcacggctcctctgaggaaggtggccatatcagattcacttgtagcatc
gtagactacaacaagagcactcaggtgtcatggttctttggaaaccgccagctccatgca
agcaacaagtatgaaatcacttacagcaacggatttgccagcatctatgtgaaggacatt
gaagagagtgataacggagtgtacaggtgcaaggttgtgagcgacgatggagaggacagt
tcttacggagagctgtttgttgaaacagtgaggagcatcagagagcattacatcagccgc
tccataaagaaactgaggaagagagtggaccaggctaaactcctgcagagaccaccagag
ttcactttacctctctacaatcgctctgcctacattggcgaggatgtgcgttttggtgtc
accatcaccgtgcaccctgagcctcaagtggcatggcttaaaaacggagagagaatcaaa
ccaggcgaggatgacaggaagtacacgttcaccagtgataagggtctgtaccagctgatg
atccacaatgtggatgcaagtgatgatgcagaatacaccgtcatggcccacaacaagttt
ggagaagacagctgcgtagcccgtctcactgtgacacctcatccagtgatggaggaaaca
atgaggcccatgttcaaacgcctgctggctaatgtggactgtgtggaaggaaacagcgtc
cgctttgagcttagagtctcaggaatcccatctcctactctgaagtggaagaaggacggt
catgcaatggagtttggccccaaggtcgttgtcatagaggaggacgttgactaccatgtc
ctgcacatcagaaacactctgctcgaggactctgctgtgtaccatgttactgcaaccaac
tgtgctggatctataagctgccaggccacactgaaggtggaccgccttacctataccagg
agggagtacaagagcgaggaagagaaatacatgcacgtacagaaacaaatcgaaaagacc
aacaaaatggctcggaaaattgttgccacggaggagatggtagctctgaaccccacggcc
caggacgcactcaagtttgctgcagagatgtataagcctgcggtgggcaccaagaacgtg
gagggagagtttgacatcactgtgcagaagtcggagactaagaagctggaagaggagagg
aggattttcatgccctatgagatcccagagcctcagatccatgatcccaaagctctggac
gaggacaaaacgatcaaacagtttgtgcctctttccgacatgaagtggtacaggaagctg
agagaccagtatgttgttccagagaggatggagaagattgtgcagaagaggcagagacgt
atccgcctttccaggtgggagcagttctatgttgtgcccctccccagaatcactgaccag
tacagaccaagatggcgtattccaaaactcagtctggatgacctggagactgtcagaccc
ggccgccgttcaccttctcctgaatccgaggcttccttcagatccagaaggagatctctg
ggagacctcagtgacgaagagctgctgatgcccgtggacgactacctctccatgaggaga
accgaggaggagaagacaatgctggaggacgaactggagctcggcttttctgcctctcct
tccggcagcccagtacgcatggaggtgcgtgaagagagaagacatgtggtccgtcacgag
gctgtggaggtcacacagaccaagaagaaacgcactgtttctcagttcatgaggaggagg
agatctctgtctcccacatacatcgagctcatgcgtccagtctcagagctgatcagacca
tctcgtgctaggactgtggaagtacagggagaggttgtgacgaggagatcccccaccccg
gagaggacacgcccccgatctcccagcccaatcaggtccgccgagaggtcgtcccgctct
tcctccaggtttgaacggaccgcccgctttgacatcatgtcccgctacgaggccagaaag
acagccctgaagtccgagaggaaataccaggtggttagccagacacccttcagcctggac
catgctccccgtgtgaccgtaaggatgcgctctcaccgcatacccatcggccaagacacc
aagttcaccctgaacatccagtccaagcccaacgctgaggtcaagtggttgcacaacgga
aatgaaatctttgagagcagcaacaaatatgtcttcaccaacatgagtggagttctgtcc
atcgctattctggactgccaagcggaagacagtggatcataccgctgcgtatgctccaac
tccaagggagatgcttccgactacgccaccctggatgtgtccggtggcggctacaccacc
ttctgctcccgccgcagggatgaggaagtcataaagggattcgtccccgaagtcaccaag
atcgaccactatcacaccactcacttcaaagctggctattctgccgagagccacttacag
gtggaagagagcaagtctaagctaacggagaaacatgaggttaccacacgggagagatac
gccgcctcctctgagaggtactcctccgctgagaggtacgattcatccatcaagttcgca
gctgctgaatacctgtcatctgattcctcctactcgtcagagaggttctccttgtctgcg
caacgcaccacatctgaagctaaagtgaagtcaacctctgtcggggaaagtgtcgtccac
aaagtggcgccttctcttcctgccaggatgctcaccaagccccagtctgtgaccgtttca
gagggagagtctgccaaattcacctttgatatcgacggagagcctgcaccaactgtaacg
tggatgcacgagagccggaccatcatctcatctcaccacgtccaggtcaccaccactcag
tacaagtccagcttcgagatctcctctgtgaccatctccgatgagggcagttacacggtt
gtggtcgagaactcggccggcaggcaggaggctcacttcaccctgaccatccgcagacca
gcacccacagaggaagtctctgcagtcaaatcccccactcccagtgtcaagtcaccagag
ccttcagtcacatcaccggcaccctctgcaacctcccccgtgcccagcatcaagtcccct
gagccttcaattaaatcaccaacgccgagtgtaaagtcaccagaaccaagtgtaacctca
cctgtcccgagtgtgaaatccccgacgccgagtgtaaagtcaccagaaccaagagtaaca
tctcccgcgccgagcgtgaagtcaccaacgccgagtgtaaagtcacctgaaccaagtgtg
acatctcccgctccgagcgtgaagtcaccaacgccgagcgtgaagtcacctgaaccaagt
gtaacgtctcctactccaagtgtgaagtccccaacaccaggggtcaaatcgcccgaacct
gagggggttaggtcaccacggggtgtaaaatctcctgaacccagggttaagtcaccaaca
caagtcaagacgccggagagagtaaagtcacctgaaccagagggagttaaatcacctttt
ggtgtgaagtctccagaacctgccggagttaaatcaccttttggtgtgaagtctccagaa
cctgccggagttaaatcacgttttggagccaaatctccagaaccagcaggaattaaatca
ccttttggagccaaatctccagaaccagcaggaattaaatcaccttttggagccaaatct
ccagaaccagcaggaattaaatcaccttttggagccaaatctccagaaccagcaggaatt
aaatcaccaagaggcctcaagtccccagaaccttcaggcatcaaatcaccaagagccttg
aagtcccctgaacccgagggcatcaaatcccctcgggtgaagtccccccctccaattatg
tcgcccaagagagttgcgtcccctcccacggtcaaatccccggtcccgaaacctcctaaa
gtcgtgagtcaagtgatggccgaggccagcgagggctcagtccggatgtcctgcgtctgc
gagagcagcgtccgggaggcggtgtggttcgtcaacgggaggaggctttcccagagcagc
cacttcgagatgcactactctgagggctcctgcagcctgctgatccacgacctggccgac
agcgaccagggagagtacacctgcgagatgacgtccgagggaggagtatccaaatcgtca
ttctccttcaccggacaggtgttccagtccattcgcatgaaggttacggcctaccacgaa
cagcaagtggcacttaaaggatcgatggcgatgagtcttaaggagtcttcactgtcctcc
gtgagctcgtccatgagctcgtccatgagctcgtccatgatgatgaagaaagagatgcac
gcgatgcaggagtcttcctccttctcctcttcctccgcccagcaggccatgatgtcgtcc
atgatggagtccagctccatgggcagcatggccgctgagatgaagttcgagaccatgtcc
atgtccagtatgtcctctttgacgtccgagacgtacgccatgagctccagcagtagcatg
gcggagggttcagcgttcagagcgatcggttctgcccccaggatcgaggctctgccggag
gacatcagcatcgagccgggcaaagtcctgacggtcacctgcgccttctccggagacgcc
aaactcatccagtggtctcgcggcgggaagaacatcgaggtgaccgccggcggacgcttc
cacatcgacaccacggaggacctgaccacgctcatcatcaccggcgtgaaggaggaggac
gccgggacgtacaccctgaaactgtccaacgagctgggctccgactcagcaaccgtccac
atcagcatccgatcagtgtaa

DBGET integrated database retrieval system