KEGG   Notothenia coriiceps (black rockcod): 104945404Help
Entry
104945404         CDS       T04920                                 

Gene name
mtmr14
Definition
(RefSeq) myotubularin-related protein 14
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00562  Inositol phosphate metabolism
ncc01100  Metabolic pathways
ncc04070  Phosphatidylinositol signaling system
ncc04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104945404 (mtmr14)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104945404 (mtmr14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104945404 (mtmr14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ncc01009]
    104945404 (mtmr14)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104945404 (mtmr14)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104945404 (mtmr14)
Protein phosphatases and associated proteins [BR:ncc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104945404 (mtmr14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 104945404
NCBI-ProteinID: XP_010769366
Position
Unknown
AA seq 446 aa AA seqDB search
MLTLFLPCSVTSSEKADKAQRYADFTLLSVPYPGCEFFKDYKDRDYTAEGLVFNWNQDYV
DAPLTIPLGFTQNLNIDWTRYQSWDLVEQTQNYLKMLLHIINSDDESGLLVHCISGWDRT
PLFVSLLRLSLWADGAVHASLQPAEILYLTIAYDWFLFGHMLPDRLSKGEEIFFFCFNFL
KHIVSEKFSTVKKQRRKNSHFKDSDFTVEDLGQLKPRDRGSVTSLSSDFSLITEEGGGAS
SLNPDPMDLFSSQPQASSWRKGPTSSPQMVVWNKPTPPDEHLSHPLSEARSSSSSSSNQS
EHAVTRTGSSPLAVPGRRLAADYPRSGSSLSTEYGSWQIVSGCGSIHDHAHFPPPLTSAS
STSSAVAAPYDSPLPFSFQDEGPSGRMCPIPSERQARLEAVREVFLAAYSSTVGLKSSAP
SPSTAITGLLEQFARGVGLRGTNAIV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccttgtttctcccctgcagtgtgacgtcctctgagaaggcggacaaggcccaa
cgctatgcagacttcaccctgctctctgtgccttacccagggtgtgagttttttaaggac
tacaaagacagagactacacagcggagggtctggtgttcaactggaatcaggactatgtg
gacgctcctttgacaatcccactgggctttactcagaacttgaacatcgactggactcga
taccagtcgtgggacctggtggagcagacccagaactacctgaagatgctgctccacatc
atcaacagtgacgatgagagcggcctcctggtgcactgcatatcaggctgggaccggacc
cctctgtttgtgtccctgctcaggctctccctgtgggcagacggcgcggtgcacgccagc
ctgcagccggcagagatcctgtatctgaccatcgcttacgactggttcctcttcggtcat
atgctgccagatcgactctccaaaggggaggagattttcttcttttgcttcaattttttg
aagcacattgtctccgagaagttctcaactgttaagaaacagagaaggaagaactctcac
ttcaaagacagtgatttcactgtggaagatctcggccagttaaagccgagggaccgcggc
agtgtgaccagtctaagcagtgacttctccctcatcactgaggaggggggcggagcctcc
agcctcaaccccgaccccatggacctgttctccagccagccccaggcctccagctggaga
aaaggccccacctcctcccctcagatggtggtttggaataaacccacccctcctgacgag
catctctcccatcctctcagtgaggccaggtcttccagctcctcctcctccaaccaatca
gaacacgccgtcacacgcactggcagcagcccactggctgtccctggaagaaggttggcc
gcagactaccctcggtccggctcctccctctccacggagtacggcagttggcagatcgtt
tctggttgtggcagcatccatgaccacgctcacttccccccccctctgacctcagcctcc
tccacctcgtctgctgtggctgctccctacgactcccccctgcccttcagttttcaggat
gaaggacccagtggaagaatgtgtcccatcccctcggagcgtcaggcccgtctggaggcg
gtgcgggaggtcttcctggcagcctacagctccaccgtgggcctcaagtcctcggccccc
agcccctccacagccatcaccggcctgctggagcagtttgcccggggggtgggcctccgg
ggcaccaacgccatcgtctga

DBGET integrated database retrieval system