KEGG   Notothenia coriiceps (black rockcod): 104946398Help
Entry
104946398         CDS       T04920                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04020  Calcium signaling pathway
ncc04270  Vascular smooth muscle contraction
ncc04371  Apelin signaling pathway
ncc04510  Focal adhesion
ncc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104946398
   04020 Calcium signaling pathway
    104946398
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104946398
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104946398
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104946398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104946398
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     104946398
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104946398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr fn3 RIO1 I-set Interfer-bind Pkinase_fungal Kdo Ig_3 FTA2
Motif
Other DBs
NCBI-GeneID: 104946398
NCBI-ProteinID: XP_010770532
Position
Unknown
AA seq 397 aa AA seqDB search
MVVRTPRIIFIVLNNNYNNNKKTLQIVDGPELWSENTDQSSTLVIAEANPQHTGRYTVVV
KDRKSSAQHTFALSVIEPPQPPASCPVISLVSPSSLVLSWSGPCYDGGSAILGYVVEVKN
QGRVDPGDWAELTAQCKSTSYKVCSGLLPQQEYCFRVRAYNAVGVSEPGPVSPVVRMEQN
DKPQEEETPQAFFCVTVDSSHKVTDHYSLQEKLGMGKFGLVFKLTHKETGRVCAGKFYKG
RRAKEREAARKEIELMNFLHHPQLVQCLAAYDHKPEMVMVMEFIAGGELFERIVDDSFVH
TELASVRYMQQILEGIAFMHQQNIVHLDMKPENIVCVDTTGTSVKIIDFGLACKIEGDTP
LKVMHGTPEFVAPEVINYEPVCLFTDMWSIGVICYIL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgaggacccccagaatcatttttattgtcttgaataataattataataataat
aaaaaaactctgcagatagtggatggtccagagctgtggtcagaaaacacagatcagagc
agcacactggtcatagcagaggctaacccgcagcacacaggccgctacactgttgtagtg
aaggaccgcaagagctctgcacaacacacgtttgctctttctgtcatagagcccccccag
cctccggcctcctgtcccgtgatctccctcgtctctcccagcagcctcgtgctctcctgg
tctggcccctgctacgacggaggcagtgctatcctaggttatgtggttgaagtgaagaac
cagggacgtgttgatcctggggattgggccgagctcacagcccagtgtaagagtacctca
tacaaagtgtgctcaggtctgctgcctcaacaagagtactgcttcagagtgagggcctac
aacgcagtgggagtcagtgagccaggaccagtgtcaccagtagttaggatggagcagaat
gataaaccacaagaagaagaaacccctcaagcgttcttctgtgtcactgttgactcttca
cacaaagtcacagatcactacagtttgcaggagaaactgggaatgggaaagttcggcctg
gtgttcaagttaacccacaaggaaacaggacgtgtgtgtgcagggaagttctacaaaggt
cgacgtgccaaggagagggaggctgctcgtaaggagatagagctgatgaacttcctccac
cacccccaactggtgcagtgtctcgcagcatacgaccacaagcctgagatggtcatggtc
atggagtttatcgcaggcggggaactgtttgaacgcattgtggatgacagttttgtgcac
actgagcttgctagtgtgcgctacatgcagcagatcctggaggggattgccttcatgcat
cagcagaacattgtccatctggacatgaaacctgaaaacattgtgtgtgttgacaccact
ggcacctccgtgaagatcattgacttcggattagcctgcaagattgaaggggacacacca
ctgaaggtgatgcatgggactccagagtttgtggcacctgaagtgatcaactatgagcct
gtgtgtttgttcactgacatgtggagcataggagtcatctgctacatattgtga

DBGET integrated database retrieval system