KEGG   Notothenia coriiceps (black rockcod): 104946946
Entry
104946946         CDS       T04920                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ncc03021]
    104946946 (aff3)
Transcription machinery [BR:ncc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     104946946 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 104946946
NCBI-ProteinID: XP_010771166
Position
Unknown
AA seq 1191 aa
MPTVLGDKGKLSIVCFLIRCAYSQVTRSQHIICAKDILEDMTQSWTSQHALGGDQAQHIL
YNPKEAKLPTAQQRQSRGDVQLRVTHHPRVAPHKSMLVDDLKLSSDEDDTQRATHESAPW
DGHSLSAHRAHTHGRRVRHSSSDSSGSDSSAESCSSSSSSSSSSSSSLHSRSRSPDPHPD
PASPPPCNNTETDHPPAAQWQLDKWLKKSRKKSTSSDHDPSQIIPGRLPSLPNNRAPSPA
RSWDIDRDYSPSQSPIPSPQFNYSHSNSPLPSPGYSFCPSPSPFPSTCPSPGPSLIPSPV
PSVCPSPCGRTRASRSPSPIPRDPPRSPSPSLPAPSKVRHYLEVQTTQPSLTTNHHRTKS
RPWITPLPNSDTKSKPTTSTHLHQHRPKTRPPQEQEQSKLKTSQIHSHKSRHKPNSNPSL
KQISEAPKAKHTSHFEQTQGSRSNHKSSHKPRPSLQSSSQHSTTTAKHLAPGSRETNSGH
SSHSQSTSKAATNPTTGLNARSNPSIKPRAKSSEAPAPVHVNQTKPTQTKAQCKELRGDH
LSQAEGRKHERKEDRHREQKQGKQGRKEDRRLAEEQLLRRPWIHSSAEEEEEEEEVIVIE
SRREERGENRRRREQQQRREWQTKPRVPTNTTQQRHQDYSHRTKKGGRSEEERELSPPPS
RSPSPHKVHSSSSSNSESESEHRAPITKVQADSTSHRKLPQRGGRSEGDRPKVVQPTGGH
PGEGGQKHYTLVPFGRSEQATAPSQRGLRNLVVHIDLCLLKRVPDSTTTSPVKKPSASSS
ASSATKDKQREAMKHLCLPEAASKDSKRKRKLENGVSHRESKRSLPHANDPSGHTEPSSL
TAERNFVTETLHNGYLEEYMDNKRPLSPLSPLSDSPETTKPPPKTKTSEQLHVHKNRDKN
RDSALKPKMEVECVKVLREPQPPESWGPAGHRGAVPNNETPHHAEYYLHEAKRMKHRADA
MVDKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPYTMYSETVELIRYAMRLKSHSGPGA
RHEDKQLAVLCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKVGYSSPKVPSTPPPGWSD
SGKGAGGPPDSLSPNGKHLNRGSNGGSAFPSHISIPQRIHQMAANHLNITNSVLYSYEYW
EVADNLAKENKEFFNYLNTLSGPLTLHSSIAHAVQYTRQALQWIRISAKLN
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgcctactgtcctcggcgacaaagggaaactttccatcgtctgttttctgatcagatgc
gcatattctcaggtaacaagaagccaacacatcatctgtgccaaagatattctggaggac
atgactcagtcctggacgtcccagcatgccttagggggagaccaggcccaacacatcctc
tacaaccctaaggaagcaaaactaccgactgcacaacaaagacaaagtcggggggatgtg
cagcttcgagtgacccatcatcctcgtgtggcacctcacaaatccatgcttgtggatgac
ctgaagctgagcagtgatgaagatgacacccaaagggcaactcatgagtcagctccctgg
gacggacacagcctgtcagcacatcgagcacacacacatggcaggagggtgagacattcc
agctctgactcgtcaggctcggactccagcgcagagtcgtgcagcagcagcagcagcagc
agcagcagcagcagcagcagccttcactcccgcagccggagcccggaccctcacccagac
cctgcatcccctccaccctgcaacaacacagagactgatcacccccctgcggctcagtgg
cagttggataaatggctgaagaagtcccggaaaaaatccaccagcagtgaccacgatcct
tcccagatcatcccaggacgccttccctctcttcccaacaacagagccccatctccagcc
cggtcctgggacatcgatcgggattacagccccagccagagccctatccccagcccacag
ttcaactacagccacagcaacagtcccctccccagcccgggttacagcttctgcccgagc
cccagtccgttccccagcacctgcccgagcccgggacccagtctgatccccagtccggtc
ccgagtgtttgccccagtccgtgtgggagaactagagccagtcgaagcccgagcccgata
ccaagagaccctccaaggagccccagtccgagcctgcctgctccttccaaggtccgacac
tacctcgaggttcagacgacacaacctagccttacgaccaatcaccacaggacgaaaagc
aggccatggattaccccattgcctaacagcgacaccaagagcaagcctacaaccagcact
catcttcatcagcaccggccgaagactcgacctccgcaggagcaagagcaaagcaaacta
aagacttctcagattcacagccacaaatctagacacaagccgaactcgaatccaagttta
aagcagatttccgaggctcccaaagccaaacacacgtctcattttgaacaaactcagggt
agtagatccaaccacaaatccagccacaagcccaggccttcgttgcagtctagctcgcaa
catagcaccacaacagcaaagcacttagcccccggaagtcgtgaaaccaactctggtcac
agttctcattcccaatctacctctaaagctgctactaatcccactactgggttgaacgct
agatcaaatcctagcataaaaccaagagccaagtcctcagaggccccggctcctgtgcat
gttaaccaaacaaaaccaacgcagacgaaagctcagtgtaaggagctcagaggagatcat
ttgagccaagctgaggggagaaaacacgagagaaaagaggacagacatcgggaacaaaag
caagggaaacaggggagaaaggaagacaggaggctggcggaggagcagctactgagacgt
ccctggatccacagttcagctgaagaagaggaggaggaagaggaggtgatagtgatagag
agtaggagagaggaaagaggggaaaacaggaggaggagagagcagcaacaacgacgcgaa
tggcaaaccaaacccagagtgcccacaaataccacgcagcaacgacatcaggactactca
cacaggacaaaaaagggaggaagaagtgaggaagagagggagttatcgcctcctccatcc
cgttccccatctcctcacaaagtacactcctcctcctcttccaattctgagtctgagtct
gaacatcgggctcccatcactaaagtccaagcggactccacctctcacaggaaactcccc
cagagaggaggcaggtcggagggtgacaggccgaaggtggtgcagcccaccggaggtcac
ccaggtgagggggggcagaagcactacaccctggtgccgtttgggcggagcgaacaagct
acagcgccttcccagagagggctgaggaacctggtggtgcacatagacctgtgtctgctg
aaaagagtcccggacagcaccactacttccccggtgaaaaagccctccgcctcttcctcc
gcctcttcggccactaaggacaagcagagagaggcgatgaaacacctgtgcctccccgag
gctgcgtcgaaagacagcaaaaggaaacgcaagctggagaacggcgtgtcacacagagaa
agcaagaggagtcttcctcatgcaaacgacccatcaggacacacagagccttcaagtctc
acagccgagcgcaactttgtgactgagactttgcacaatgggtacttggaggagtacatg
gacaacaagaggccgttgtctcctctgtctccgctgtcagacagccctgagaccaccaag
cccccccccaaaacaaagacttccgagcagctccatgtccacaagaacagagacaagaat
agagattctgctttaaagcccaagatggaggtggaatgtgtcaaagtgttgagagagccc
caaccgcctgagtcctggggccctgcagggcacagaggggccgtgccaaacaacgaaact
ccgcaccatgctgagtactacttgcatgaagccaagaggatgaagcaccgcgcagacgca
atggtggacaagctggggaaggctgtgaattacgtggacgccgctctgtccttcatggaa
tgtgggaaagcgatggaggaagggccgctagaggcaaagtctccctacaccatgtactca
gaaaccgtggagcttatcaggtacgccatgaggctgaagagccactccgggcccggggcg
agacacgaagacaaacagctggcggtgctttgtttccgatgccttgcacttctttactgg
caaatgtttcgtttaaagaaggaccatgcactgaaatactccaaagttctgctggactac
tttaaggtaggctatagttctcccaaagtgccttctacaccccctcccggttggagtgac
tctgggaagggagcaggaggaccccctgattcactctcacccaacggcaaacacctgaac
cgggggtcaaacgggggcagcgccttcccctctcacatcagcatcccccagcgcatccac
cagatggcagccaaccacctgaacatcaccaacagcgtgctgtacagctacgagtactgg
gaggtggctgacaacctggcaaaggagaataaagagttcttcaactacttgaatacgttg
tctgggcctttgactcttcacagtagcatcgctcacgcagtccaatacaccagacaggct
ctgcagtggatacgcattagtgccaaacttaactga

DBGET integrated database retrieval system