KEGG   Notothenia coriiceps (black rockcod): 104947038Help
Entry
104947038         CDS       T04920                                 

Gene name
mapk15
Definition
(RefSeq) mitogen-activated protein kinase 15
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104947038 (mapk15)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104947038 (mapk15)
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104947038 (mapk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 104947038
NCBI-ProteinID: XP_010771269
Position
Unknown
AA seq 613 aa AA seqDB search
MSKKYQSTNVSEVEDHISLKYEIKKRLGKGAYGIVWKAVDRQTGEIVAVKKIFDAFRNRT
DAQRTFREIMFLQEFGDHPNIVQLLNVVRAQNDKDIYLIFEYMDTDLHAVIKKGTLLKDI
HKRYVMYQLFKAIKYLHSGNVIHRDHKPSNVLLDTDCVVKLCDFGLARSLNQIQEDSGNP
ALTEYVATRWYRAPEILLGSTRYTKGVDMWSLGCILGEMLLGEALFPGTSTINQIEKIMT
TIPHPSPEDILAIKSEYGSSVIQRMLLKPQVPLEDLLQPSVPPDALDLLRGLLVFNPDKR
LTAEQALQHPYVARFHNPAKEPALNYDVVLPVDDDVQLSVVQYRNTLYEMMLERRTNQGM
LRLIQPKDGRSVRSVEKPNVKEKVEKGLVKVSGDNDHKGETQHVKTEESNPEPLQTAVPE
PAPVSTPPAVEKRSPLSSPDGLGKLTYNPITHAPNAFVRSPAGPPHHGFSTAAGRKHVGP
TSNGSATTSPTEGSNTDESMDQILQRGRSAPVAHTSSFSSTLNQTQNHPLVRKEEPSLPS
GLYVTSARLNQRSNPPVREARPPTRFSKKVYQSNCNVAAAGDPRAKLGSYCQAYGTINKT
DLDNLLRSRPYNQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaatatcaatcaacaaacgtttctgaggtggaggaccacatttctctcaag
tatgaaatcaagaagagacttggaaaaggggcttatggcattgtatggaaagctgttgac
agacaaacaggcgagatcgtggccgtgaagaagatctttgacgccttcaggaacaggacg
gatgcccagcggacattcagggaaatcatgttcctccaggagtttggcgatcatcccaac
atcgtccaacttctaaatgtcgtcagagctcaaaatgataaagacatttatcttatcttt
gagtatatggataccgacctgcatgcagtgataaagaaaggcacccttctgaaggacatc
cacaaacgttatgtgatgtaccagctcttcaaagccatcaaatacctacactcaggaaat
gttatccacagggaccataagccatccaacgtgttgctggacaccgactgtgtagtcaag
ctgtgtgatttcggcttggccagatcgctcaatcagatccaagaggacagtgggaatcca
gcgctgacggagtacgtggcgacgcggtggtaccgagctcctgagatcctgctggggtcc
acaaggtacactaaaggtgtggacatgtggagcctcggctgtatcctgggagaaatgctg
ctgggggaagcgctgttccctgggacgtccaccatcaaccagatagagaagatcatgacc
accataccccaccccagcccagaagatattctagcaatcaagtctgaatatggatcctca
gtgattcagagaatgttactaaaaccacaggtgcctttggaggatcttctccagccttct
gtgcctccagatgctctggacctgttgagaggtttgctcgttttcaacccagacaagcga
ctgaccgctgagcaagccctgcaacacccatatgtagccaggtttcacaatccagccaag
gagcccgcccttaactacgatgtcgtgcttccagtggatgatgatgtacaactatctgtg
gttcagtaccgcaacacactttatgagatgatgctggagaggagaactaatcaggggatg
ctgaggctaatccaaccaaaggacggacgctctgtcagaagcgttgagaagcccaatgtg
aaggagaaagtagagaagggactagtcaaagtgagtggggacaatgaccataagggggaa
acacaacacgtaaagactgaagagtcaaacccagagcctttacaaacagccgtccctgaa
cctgcgcccgtgtcaaccccgcctgctgtggagaagaggagtcccttatcgagtcccgac
ggtttgggaaaactcacctacaaccccatcacacatgccccaaatgcttttgtccggagt
ccggctggtcctcctcatcacggcttctccactgcagcaggcaggaaacacgtgggaccg
accagtaatggaagtgcaacaacatcaccaacagagggcagcaacactgatgaatccatg
gatcagattctccagcgtggtcgctccgcccctgtggcccacaccagctccttctcctcg
accttaaaccaaacccagaaccacccgctggttcgcaaggaagagccctccctgccctct
gggctgtacgtcacatctgcccgcctgaaccagcgctccaaccctccggttcgtgaggct
cggcccccaacacgcttcagcaagaaagtgtatcagagtaactgtaatgtggccgcagca
ggcgaccctcgagccaaactgggcagctattgccaggcctatggcacgatcaacaagact
gatctggacaatctgctacgaagccgcccgtacaaccagtag

DBGET integrated database retrieval system