KEGG   Notothenia coriiceps (black rockcod): 104947942Help
Entry
104947942         CDS       T04920                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8-like
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00061  Fatty acid biosynthesis
ncc00140  Steroid hormone biosynthesis
ncc01100  Metabolic pathways
ncc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104947942
   00140 Steroid hormone biosynthesis
    104947942
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     104947942
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     104947942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Epimerase 3HCDH_N 3Beta_HSD SBD_N RmlD_sub_bind 2-Hacid_dh_C ADH_zinc_N TrkA_N UPF0146
Motif
Other DBs
NCBI-GeneID: 104947942
NCBI-ProteinID: XP_010772366
Position
Unknown
AA seq 134 aa AA seqDB search
MAAATRLISRLTLVTGGGSGIGRAVCQRLASEGASVVVADISEESAHDTLGSLQRDLRGQ
GHMAAVVDVSSKESVKNLVTRIQTHYFQPPSVCVNAAGITQDDFLLNMDEDHFDNVIRVN
LKVRSLYRKANRRG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccacaagactcatatcaaggttgacactggtcactggaggaggcagtggg
atcgggcgggcggtgtgtcagcgcctcgcctctgagggcgcctctgtggtggtcgctgac
atcagcgaggagtcggcccatgacaccctggggagcctgcagagggacctcagagggcag
ggtcacatggcggctgtggtggatgtgtcttcaaaagagagtgtaaagaatcttgtcaca
agaatacagactcactactttcagcctccgtcagtgtgtgtgaacgcagcaggcatcacc
caggacgacttcctgctcaacatggacgaggatcattttgacaatgtcatccgggtcaac
ctgaaggtacgcagcctgtaccgcaaagctaatcgtagaggttag

DBGET integrated database retrieval system