KEGG   Notothenia coriiceps (black rockcod): 104949169Help
Entry
104949169         CDS       T04920                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP10-like
  KO
K09575  FK506-binding protein 9/10 [EC:5.2.1.8]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ncc03110]
    104949169
Enzymes [BR:ncc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104949169
Chaperones and folding catalysts [BR:ncc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    104949169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_1 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 104949169
NCBI-ProteinID: XP_010773771
Position
Unknown
AA seq 305 aa AA seqDB search
MDLLIYSALFCLHVLTVYCNFVDVVVDRYDIPRVCPREVGTDDFIRYHFNGTFFEDGKKF
DSSYDRGKAFISQVGFGRLIAGMDRGLQGMCVNEKRRITIPPHLAYGSIGAGEETHDEKL
SSGYEEAEIGLEASSETPSTVSSDQFDSPSITTLGANMVIPGLEEGLRGMCVGERREVVV
PPHWGHGENGAGDVPGSAVLFFELELVKLQKGIPEGFMFVWLGDSPDPLFPAMDLNGDKE
VPLEEFSAFIMLQVKEAKGRLRPGFDAGTIIQDMFNNQDLNKDGKIIEDELKLQGESQQV
RRDEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatctgttaatatatagtgctttattttgccttcatgtacttacagtttattgtaat
tttgtggacgttgttgtggatcggtacgacataccgagagtttgtcctcgagaagtgggg
actgacgattttatccgttatcactttaacggaaccttctttgaagacgggaaaaagttt
gactccagctatgaccgaggcaaggccttcatcagccaggtgggctttggcagactgatc
gctgggatggaccgaggccttcagggcatgtgtgtcaatgagaaaaggaggatcaccatc
cccccccacctggcctatgggagcattggggcaggtgaagaaacacatgatgaaaaactt
tcctctggatatgaagaagctgaaattggccttgaggcttcatctgaaactccatcaact
gtctcctcggaccagtttgactccccctccatcacgactctcggagcgaatatggtgatt
ccgggtctggaggaaggtttgagaggcatgtgtgtgggcgagaggagggaggtggtcgtt
ccaccacactggggacatggtgaaaatggagctggtgatgttcccgggagcgccgtgctc
ttcttcgagctggagctagtgaagctgcagaaaggtattccggaaggcttcatgtttgtg
tggctgggggacagcccagaccccctctttcctgccatggatctcaatggtgacaaagag
gtccctctagaggagttttcggccttcatcatgctccaggttaaggaggccaaaggtcgt
ctgcggccagggtttgatgccggcaccatcattcaggacatgttcaataaccaggactta
aataaagacgggaagattatagaagatgaactgaaacttcagggggagtctcaacaagtg
agacgagacgagctgtaa

DBGET integrated database retrieval system