KEGG   Notothenia coriiceps (black rockcod): 104950422
Entry
104950422         CDS       T04920                                 

Gene name
erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104950422 (erap1)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     104950422 (erap1)
Peptidases and inhibitors [BR:ncc01002]
 Metallo peptidases
  Family M1
   104950422 (erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 104950422
NCBI-ProteinID: XP_010775241
Position
Unknown
AA seq 937 aa
MLAAPLLLLLFLPFPPSSGAQLPDTDRVQVDLKAPPFPWGSMRLPKTISPKHYDLTIHPN
LTTLDFTGVVRIQLDVHEDTNAIILHSKHLHISNVLLFATEGVKPLKVSEHPRFNQLALE
SDSVLAKGRRYEVQLEFAANFSESYHGFYKSSYRTSSGEVRVMASTQFEATFARLAFPCF
DEPAFKANFTIRITREPRHIAISNMPMVKTDELPGGLLKDHFDTTVKMSTYLVAYIVSDF
LSVSKTTQHGVKISVYAVPEKIDQTAFALEAAVKLLDFYDDYFDIPYPLPKQDLAAIPDF
QSGAMENWGLTTYRETGLLFDPDKSSASDKLGITKVIAHELAHQWFGNLVTMEWWNDLWL
NEGFAKFMEFISLRATYPELQVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMFD
DVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRYSYQNTVNSHLWESLTNVCNSDDLDEG
RIKHKEFCSKRDVQSGATKWYSGDELDVRAIMDTWTLQEGFPLVTVEVKGREVRLSQERY
LKTDDYSLTEGFLWQIPLTYMTSTSSTVHRFLLKTKTDVLDLPEEADWVKFNVDMSGYYM
VHYAGEGWNSIIKLLHHNHTALSSNDRASLIHNVFQLVSTEKVRLDTALELSLYLSKETE
IMAVTQGFGELVPLYKLMEKRDMAALENQMKDYIVDLFRGLIGRQEWTDSGSVSQRVLRS
YLLLFGCFRNYAPCVSKATELFTKWKESDGTMSLPVDITMAVFLIGARTPEGWDFLLEKY
RSSLQMSVKSRMKSAMSTSPLQEKLKWMMKHSLSNVVMKTQDLPDVMVSVSRNPRGYKMA
WDFLRANWHILIKKFELGSSTVSFMVTGVTSQYSTREMLEEVRSFFGSLDEDSGSEMRCI
RQAYETIEDNIRWTDRNLPLLQAWLNKRRPKPLHEDL
NT seq 2814 nt   +upstreamnt  +downstreamnt
atgttagcagcacctctgctgttgctgctgttcctcccttttcctccctcatcaggagca
cagctaccagatacagatcgagttcaggttgacctcaaagcaccccctttcccctggggc
agcatgaggctccctaaaaccatctcccccaaacactatgacttgaccatccaccccaat
ctgaccaccctggacttcactggcgttgttcgtatccagctggacgtgcacgaagacacc
aacgccataattctccactccaagcatctgcatatatctaatgtgttgctctttgcaact
gaaggtgtgaagcctctcaaggtgtcggagcatcctcgtttcaatcagctcgccctggag
tcagactcggtgctggccaaagggaggaggtatgaagttcagctggagttcgctgccaac
ttttccgagagctaccatggtttctacaagagcagctaccgcaccagcagtggggaagtc
cgggtcatggcctccacgcaatttgaagccacctttgctcgattagccttcccctgtttt
gatgagcccgccttcaaagccaacttcaccatacggattacacgagagccacgccacata
gccatatccaacatgcccatggtaaaaactgatgagctgccaggcggtttgcttaaggat
cacttcgacaccactgtaaaaatgagcacttacctggtggcctacattgtgtctgacttc
ctgtctgtgagcaagaccacccagcatggtgtcaagatttcagtctacgccgtccctgag
aagattgaccagacagcctttgcgctggaggctgctgtcaagctgttggacttctacgat
gactattttgatattccttacccattacccaaacaggacctggctgctatccctgacttc
cagtcgggtgcgatggagaactgggggctgaccacctacagagagacgggtctcctcttt
gaccctgacaagtcctcagcttcagacaaactgggtatcaccaaagtcatcgcccatgag
ctcgcacaccagtggtttgggaacctggtgacgatggagtggtggaacgacctgtggctc
aatgagggttttgcgaagttcatggagtttatttctctcagagccacctacccagagctg
caagtggatgacttcttcttggggaaatgttttgaggccatggaggtagactctctcagc
tcctcccacccagtctcgactcccgtggaaaaccccacgcagatccaggagatgttcgac
gacgtttcatacgacaagggggcatgtattctgaatatgctgcgagacttcctgactcct
gaggcttttgagattggcatcatccgatacctgaagcgctacagctaccaaaacaccgtc
aacagccacctgtgggagagcctgaccaatgtctgcaactcagatgatctggacgaaggc
cggattaagcacaaagaattctgctctaaacgtgacgtccagtctggagccactaaatgg
tactctggtgatgagctagatgtccgggccatcatggacacctggacgctgcaggagggc
ttcccattggtcactgtggaggtcaaaggtcgggaggtcaggctcagtcaggagcgttac
ctgaagacagacgactactctctcactgaaggatttctttggcagatccctctgacctac
atgaccagcacctccagcaccgtgcaccgcttcctgctcaagacaaagaccgatgtcctg
gacctgccggaggaggcggactgggtgaagttcaacgtggacatgagcggctactacatg
gtgcactacgcaggcgaggggtggaactccatcatcaaactgctgcaccacaaccacacg
gcccttagcagcaacgaccgcgccagcctcatccacaacgtcttccagctggtcagcacg
gagaaggtgaggctggacacggctctggagctgtctctgtacctgtccaaagagaccgag
atcatggctgtgactcagggctttggagagcttgtgcctctgtacaaactgatggagaag
agagacatggctgctctggagaatcagatgaaggactacattgtggatttgttccggggg
ctgattggccggcaggagtggactgactctggatcagtgtctcagcgagtgctgaggagc
tacctgctgctttttggatgcttcaggaactacgctccctgcgtgtcaaaagccaccgag
ctctttaccaagtggaaggagtctgacggcaccatgagcctccctgtcgacatcaccatg
gcggtgtttctgattggagctcgaacaccagaggggtgggacttcctgttggagaagtac
cgcagttccctgcaaatgtctgtaaagagccgcatgaaatctgcaatgtccaccagtcct
ctgcaggagaagctcaagtggatgatgaagcacagcctctccaatgtggtgatgaagact
caggacctcccggacgtgatggtctccgtcagcaggaacccccgcggctacaaaatggcc
tgggacttcctccgagcaaactggcacatcctgatcaagaaatttgaattgggatccagc
actgtttcattcatggtgactggggtgactagccagtattctaccagggagatgttagag
gaggtgagaagcttcttcggctctctggatgaggattcaggctcagagatgagatgtatc
cggcaggcctacgagaccatcgaggataacatccgctggacggacagaaaccttcctctg
ctgcaggcctggctgaacaaacgcagacccaaacctctgcatgaggatctttag

DBGET integrated database retrieval system