KEGG   Notothenia coriiceps (black rockcod): 104950648Help
Entry
104950648         CDS       T04920                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104950648
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104950648
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104950648
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: STE group
  STE20 family
   104950648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH AAR2
Motif
Other DBs
NCBI-GeneID: 104950648
NCBI-ProteinID: XP_010775494
Position
Unknown
AA seq 681 aa AA seqDB search
MDFQESNLARLLLAAGLPSQVQSRLGSGSSSSPCTPAMQRAHLNQNANLRSSRDAPHSSS
MSDMAISPLSPLSPMSPTDDVFWDSRVPPKVPERTTSKFYCRELVMGHKRAASSGSPVSV
ADQRSVSQGAPPTGSNHPGFFKLESPLLQHRLQQHRRTQDNVTSGQTQGVRSALIRLHKA
TEYSSSSDEVGSSDDEERNRSDLSNGKGKYFRGIPDGIVLQPHHNLNQISRVAADDTYML
PDLLQKTSSSSPTHNALGQEQRRRELNYSQSPTAPRSPTHQELHAISSPTGKNTSTSSSS
SFLSFIDPRLIPISSPPQSPVGIKGELIKRENHRKGSVVNVNPTNIRPQSDSPEIRKYKK
KFNTEVLCAGLWGVNLLVGTENGLWLLDRSGQGKVYSLISRRRFQQMDVLEGLNVLITIS
GKKNKLRLYYLSWLRNKILHNDPEVEKRQGWTSVGDLEGCVHYKVVRYDKIKFLVIALKN
AVEVYAWAPKPYHKFMAFKSFRSLPQKPMSVDLTVEEGQRLKVIYGSLSGFHAIDVDSGT
PYDLYLPTHKGTMVFKTCGDDRLQQGPVEDVCEHLCQLSCTNPENTARDAIRSRSLVLLG
KGGAGLSVTPLRLPRINKQLGCTDRAVNSDTLLADVKASSNAVFHNSPFRENSSRGSNGS
VTRALSTNGRSRRRALLGAAS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggacttccaggaatcaaacctagccaggctgctcttagctgctggtctccccagccag
gtacagtccaggctgggctcagggagcagctccagtccctgtactccagccatgcagagg
gctcacctcaaccagaatgccaatttgcgctcaagtcgagacgcccctcacagcagctcc
atgtcagatatggccatctccccgttgtccccgttgtcccccatgtctccaactgacgac
gtcttctgggactctagagtgccacctaaggtcccagaacgcactacctccaagttctac
tgtcgcgagctggtgatgggacacaagagggcagcttcaagtggcagtccagtgtctgtg
gcagatcaacgctcagtgtctcagggagcccccccgactggcagcaaccacccagggttc
ttcaagctggagagtcctcttctacaacaccgtctccagcagcacaggaggacacaggac
aatgtgaccagtggacaaacacagggtgtccgatctgctctgattcgcctgcacaaggcc
acagaatattcatcttccagtgacgaggttggcagcagcgatgacgaagagaggaacagg
tctgacctgtccaatggaaaggggaaatacttcagaggaatacctgatggaatcgtgctg
cagcctcaccacaatctcaatcagatttctcgtgtagctgcagatgacacctacatgcta
ccagaccttctgcagaaaacctcctcctccagtcctacccacaatgcactgggccaggag
cagcgaaggcgtgaactgaactactcgcagtcccccacagcccctcgatcccccacacac
caggaactacatgccatcagcagtcctactggtaaaaacacttccacgtcttcttcttcc
tccttcctgtcattcatcgatccaagattgatccccatatcatcgccaccccagagccct
gtgggcattaagggtgagctgattaagagggagaaccacaggaagggctcggtggtgaac
gttaacccgaccaacatccgaccgcagagcgactctccagagatcaggaagtacaagaag
aagttcaacactgaggtcctctgtgctggactctggggtgtgaatctgttagtgggaaca
gagaacggtttgtggctgctggatcgcagcgggcaggggaaagtctactcgctcatcagc
agacggaggtttcaacagatggatgttttggaaggactcaatgtactaatcaccatatca
ggtaaaaagaacaagctccgtctgtactacctgtcctggttgaggaataaaatcctgcac
aacgacccagaggtggagaagagacagggctggacctcagtaggtgacctggagggttgt
gttcactataaagtggtgcgttacgacaagattaagttcttggtgattgctttgaagaac
gcagtggaggtgtacgcctgggccccaaaaccctaccacaaattcatggccttcaagtcc
ttccggtcgctgcctcaaaagccgatgtctgttgacctgacagtagaggaaggccagagg
ttaaaggtcatctacggctccctctcaggtttccacgccattgacgttgactctggaaca
ccttacgacctctacctgcctacacataaaggaacgatggtgtttaaaacatgtggggac
gacagactgcagcagggacctgttgaagatgtctgtgaacacctctgccagctgagctgc
acaaaccctgagaacacggccagggatgccatcaggtccaggagccttgtgctcttgggc
aaaggaggggctggtctgagtgtcaccccgctccggttaccccgaatcaacaagcaactc
gggtgcaccgacagagcggttaactcggacactctcttggctgacgttaaggcaagtagc
aatgctgtcttccacaacagtcctttcagggagaacagctccagaggctcaaatggttct
gtgaccagagccttgagcaccaacggcaggtcccggaggcgtgcactactgggcgcagcc
tcctga

DBGET integrated database retrieval system