KEGG   Notothenia coriiceps (black rockcod): 104950890Help
Entry
104950890         CDS       T04920                                 

Definition
(RefSeq) dedicator of cytokinesis protein 6-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104950890
Membrane trafficking [BR:ncc04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    104950890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 104950890
NCBI-ProteinID: XP_010775788
Position
Unknown
AA seq 477 aa AA seqDB search
MTSTASERRAFAHKINRTVAAEVRKQVSRDYGSPQLSKKRGAHQPLPLTEVVEPVDFEEY
VSSHAPGVEPGPLRQLMEFPQDDLELLPLDKECITLEPPLPEEEDSLDPRVRDALAVYTD
DWLVIQRKYQRYSTTYSPQSSERQRERQRGLQKQTFELDEAASERHDDQDDAKRRSVSLD
ETPRGSWASSIFDLKNSSPDAILPSVLERAAAEDMDRRNTEARLQGRHSDLLGLYPPPDE
DEAVERCSAPEVPKEHCGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFYFDL
NSDQMKGMLKPHTPHVAISTMARSAIFSITYPSADIFLVIKLEKVLQQGDIGECCEPYMV
MKESDSSKHKEKLEKLRLQAEQSCSRLGRFRMPFAWTAIHLLNIVSSVGGLDRSDPDSDS
ERKGHGTWNDRKKKGCERMSVGDDMCNFATFRPATLTVTNFFKQLSIVTFNDNKVRR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacatctaccgcgagcgagaggagggcgtttgctcataaaatcaaccggacggtggct
gcagaagtcagaaaacaagtttccagagactatggctctcctcagctctccaagaaacga
ggcgcacaccaacctttgcccctgacggaggtggttgagcctgtggacttcgaagagtat
gtgagcagtcacgctccgggggtggagcccggaccgctccggcagctcatggagttcccc
caggacgacctggagctcctcccgctggacaaagagtgcattacactggagcccccactg
cctgaagaggaagactctctagatcccagagtgagagatgccttggcagtctacacagat
gactggctcgtcattcaaaggaaatatcagcgctacagcaccacgtacagccctcagagc
tctgagcggcagagggagaggcagcgagggctgcaaaaacagacctttgagctggacgag
gctgcttcggagcgccatgacgaccaggatgatgcaaagcgccgttcagtcagcctcgat
gagactcctcggggaagctgggcctccagtattttcgacttgaagaattcctccccagac
gcgatcctgccgtctgtgctggagcgagcagccgccgaggacatggaccgccgcaatact
gaggcccgcctgcaggggcgccacagcgacctgctgggcctctacccgccccccgatgag
gatgaagcagtagagagatgctctgcccctgaagtgcctaaggaacactgtggtcagagg
atcatggttaagtgcctgtctctgaagtttgaaatagaaattgagccgatatttggaaca
cttgccctgtatgacgtcaaggaaaagaaaaagatctctgagaatttctacttcgacctg
aactcagatcagatgaaaggaatgcttaaaccccacacacctcacgtagccatttccaca
atggcccgttctgccattttctccatcacctacccttcggccgatatcttcttggtcatt
aagcttgagaaagtccttcaacaaggggacattggagaatgctgtgaaccctacatggtt
atgaaagagtctgattcctccaagcacaaggagaagctggagaagctgcgtctgcaggca
gagcagtcatgtagtcgtctcggccgtttccgcatgcctttcgcctggacggccattcac
ctgctcaacatcgtcagcagtgtggggggtctggatcgctcggaccctgactccgactct
gagcgaaaaggccacggaacatggaatgacagaaagaaaaaggggtgcgagcggatgagt
gttggggacgacatgtgtaactttgccactttccgtccagcaacattgaccgtcaccaac
ttcttcaaacagctcagtattgtcacttttaacgacaacaaggtgaggcgctaa

DBGET integrated database retrieval system