KEGG   Notothenia coriiceps (black rockcod): 104951204Help
Entry
104951204         CDS       T04920                                 

Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04068  FoxO signaling pathway
ncc04110  Cell cycle
ncc04114  Oocyte meiosis
ncc04115  p53 signaling pathway
ncc04218  Cellular senescence
ncc04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104951204
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104951204
   04114 Oocyte meiosis
    104951204
   04115 p53 signaling pathway
    104951204
   04218 Cellular senescence
    104951204
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104951204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104951204
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ncc03032]
    104951204
   03036 Chromosome and associated proteins [BR:ncc03036]
    104951204
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104951204
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104951204
DNA replication proteins [BR:ncc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104951204
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104951204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 104951204
NCBI-ProteinID: XP_010776142
Position
Unknown
AA seq 102 aa AA seqDB search
VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMLTKRALFPGDSEIDQLFRIFRTLGTP
DETVWPGVTSMPDYKPSFPKWARQDLAKVVPILDEDGRELLG
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacactttggtacagagctccagaaatcctcctgggctgtaaatactactccaca
gctgtcgacatctggagtctgggctgcatctttgctgaaatgctcaccaagagggccttg
ttccccggagactcagagatcgatcagttattcaggatcttccgcaccctgggcacgcct
gatgagaccgtctggcctggagtcacatccatgcccgactacaaaccctccttccccaag
tgggcccggcaggatttagccaaagtggtgccgattctcgatgaagatggaagagaactg
ctcgga

DBGET integrated database retrieval system