KEGG   Notothenia coriiceps (black rockcod): 104951649
Entry
104951649         CDS       T04920                                 

Definition
(RefSeq) uncharacterized protein LOC104951649
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104951649
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104951649
SSDB
Motif
Pfam: PAS PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 104951649
NCBI-ProteinID: XP_010776660
Position
Unknown
AA seq 671 aa
MHESLNRDSGMTEGGRAYQDKSRERDGRTSSLYTVQQFVECEIQSLGKGNDQAKSHSISQ
LTGLFYSFIGNNEKPSRKQSISTASSNPEPRKDSTLPGTTIHESSLLLESLTGFALVVSS
DGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFKRQLHWAMCPPQGSQAHQDHQ
QAAGNGEEFVVSSIFHSPEAGGIPPELSCFLNRCFLARVRCLLDSTSGFLTVQFQGRLKF
LNGQKKKSGSGALLPPQLALFCIGVPLLLPSITEMKMKNMLMRGKNKGGVGEPGDPLRRH
SFSGGMGDIADPLLLSCPTPGGTQRGQHTPWTPLSKDNLKYRADGYYNQDEPLNYCKSTM
APHKGVSPGLGGGWPLRPNSGPLRSGQGVGYIPSNRMNKAGQYGKPYRLSPNCHSGRNGE
VFVSKLYGNVQIPSDPDAYCVDLVKNENGYGDCYDGHMMPEMQPIKIEHDSDSENGCDAY
GQPWGCRDPEAIDRRYGNGVYDQNAHLKTEAEYYDPQYSPCQRGKAGISPPYNNGNYQNY
AMNNGGNATARLLKCDKDMGNNNDNNQFSPQRLSHSNSVCSNQSINLMDTHVYPQDPHKA
YMHPDYNKHGNYEFKGHGIVHSIKREPMDSPPWSESTHDISQSMMMVGQRNVMPCVMSTG
HHKSSPYIYMP
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgcatgagtcgctcaacagggacagcggcatgacggagggagggagggcataccaggac
aagagccgggagagggatgggagaacaagttctctgtatactgttcagcagtttgtcgag
tgtgaaatacagagcctcggcaaaggcaacgaccaagctaaaagtcactctataagccaa
ttgaccggtttattttattcttttatagggaacaatgagaagccctccaggaagcaaagt
atcagcacagcgtcctctaaccctgaacccaggaaagacagcactctaccgggcaccacc
atccatgaaagcagcctcctcctggaatctcttacaggctttgccttggtggtgagcagt
gatgggatggtattttacgcctcttcaaccatcgtggactatctgggatttcatcagact
gacgtgatgcaccagaatgtgtttgactacattcacatagacgatcgccaggagttcaaa
cgccagctccactgggccatgtgccctccacaggggtcacaggcacaccaggaccaccag
caggctgcagggaatggtgaggagtttgtagtgagcagcatcttccattctccggaggcc
ggggggattcctcccgagctctcctgctttctcaacagatgcttccttgccagagtccga
tgcctcttggacagcacctctggattcttgactgtgcagttccagggacgtttgaagttc
ctcaacggtcagaaaaagaagtccggctccggggctctgctgcccccccagctggctcta
ttctgcataggtgtacccctcctactgccctccatcaccgagatgaaaatgaagaacatg
ttaatgcggggaaagaacaaaggaggagttggtgagcctggagaccccctgcggaggcac
tctttcagtggaggaatgggtgacatagcagaccctctcctcctgtcctgtcccactcct
ggtggaacccagcggggtcagcacactccttggaccccgctctccaaagacaacctcaag
taccgcgctgatggttactacaaccaggatgagcccctcaactactgcaagtccaccatg
gctccccataaaggggtcagcccgggccttggcgggggctggcctctgcggccgaactcc
ggccccctcagatcgggccagggtgtcggctacatcccctctaaccgcatgaacaaggcc
gggcagtatgggaagccatatcgtctttccccaaactgccacagcggcagaaatggcgag
gtgtttgtgtccaagctctacgggaacgtacagatcccctcggacccagatgcctactgc
gtggatctggtgaagaacgagaacggctacggggattgctacgacggccatatgatgccc
gagatgcaacctatcaagatagagcacgactctgactcagagaacggctgcgatgcctac
gggcaaccctgggggtgccgcgacccggaagccatcgaccgccgctatggtaacggggtg
tacgaccagaacgcccatctcaaaacagaagcggaatattacgatccacagtactcgcct
tgtcagcgagggaaagcgggaatcagcccgccgtacaacaacggcaactatcagaactat
gcaatgaacaacggcgggaacgcaaccgcacgtctgttgaaatgtgacaaagacatgggc
aataacaacgacaacaaccagttcagtcctcagagactctctcactcaaactctgtatgc
agcaaccaatccatcaacctcatggacacacacgtctacccacaggaccctcacaaggcc
tacatgcacccggactacaacaagcatggcaattacgagttcaaaggtcacggcatcgta
cactccatcaagcgggagcccatggactcccccccgtggtctgagagcactcacgacatc
agccagtccatgatgatggtcggtcagaggaacgttatgccatgtgtgatgagcacaggc
caccacaagtccagtccttacatttatatgccataa

DBGET integrated database retrieval system