KEGG   Notothenia coriiceps (black rockcod): 104951661Help
Entry
104951661         CDS       T04920                                 

Definition
(RefSeq) myotubularin-related protein 6-like
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00562  Inositol phosphate metabolism
ncc01100  Metabolic pathways
ncc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104951661
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104951661
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ncc01009]
    104951661
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104951661
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104951661
Protein phosphatases and associated proteins [BR:ncc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104951661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xylo_C
Motif
Other DBs
NCBI-GeneID: 104951661
NCBI-ProteinID: XP_010776679
Position
Unknown
AA seq 191 aa AA seqDB search
MSERENYLNPFYSPAYSKAHPVLQPSTLPYHFKFWRNMYHQFDRSMHPRQSILKTVLNLR
EEGRKAESALQALENRLLQLGVTPVVTSDPPAPPPTRDQHCNTLPARPDSLILGAPINHK
EVERQEEEFDQEEVGEEATESTDTERSVEGSSGTDSRKQSYGELDGTYSSELAKEEPAAV
SLEFGVARMTC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagggagaactacttgaatccgttctacagccctgcatactctaaagcccac
cctgtgctgcagccctccactctgccctaccacttcaagttctggaggaacatgtaccac
cagtttgatcggtctatgcacccccgtcagtcgatcctcaaaaccgttctgaatctgaga
gaggaaggccgcaaggcagagagcgcactgcaagcgctggagaatcggctccttcagctc
ggtgtgacccccgttgtgacctctgacccccctgcacctcctcccaccagagatcaacac
tgcaacaccctcccggcgcggcccgattcactcatcctgggggctcccatcaaccacaaa
gaggtggagcgacaggaggaggagttcgatcaggaggaggtgggcgaggaggccacagag
agcactgacacagagcggtcagtggagggcagcagcggcaccgacagcaggaagcagagc
tacggagagctggatgggacatacagcagcgagttggccaaagaggagccagctgctgtg
agcctggagtttggagtggcgcgtatgacctgctga

DBGET integrated database retrieval system