KEGG   Notothenia coriiceps (black rockcod): 104951896
Entry
104951896         CDS       T04920                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
ncc04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104951896 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104951896 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 104951896
NCBI-ProteinID: XP_010776935
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTEHGRGLQQAATVRKIVQQNSARGGQSHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacagaacatggcagagggctgcaacaggcggccacagtc
agaaaaattgtccagcaaaactctgcgaggggcggccagagccacagaccagccggctgg
aagaggagacgcccacggccacgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system