KEGG   Notothenia coriiceps (black rockcod): 104952207
Entry
104952207         CDS       T04920                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00230  Purine metabolism
ncc00240  Pyrimidine metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104952207 (dck)
   00240 Pyrimidine metabolism
    104952207 (dck)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104952207 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 Gp_UL130
Other DBs
NCBI-GeneID: 104952207
NCBI-ProteinID: XP_010777281
UniProt: A0A6I9NS36
Position
Unknown
AA seq 267 aa
MSLTPKRPSPDSIDDSMEKRHEKRIRRISIEGNIAAGKSTFLRLLDQESGDWEVVPEPIA
RWCNVQTKGSDFEELTTSQRSGGNVLQMMYEKPERWAYTFQSYACISRVRAQITSANGKL
REAENPVQFFERSIYSDRYIFAANLYESECLNETEWSIYQDCHGWLHSQFGKHIELDGII
YLRAAPEKCLQRLHLRGREEEQDIPLEYLEKLHFKHESWLRHKTMRTDFEYLNDVPVLTI
DINEDFKGNNSKSADMIEKVKEFLSTL
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtctttaactccaaagaggccgtctcccgactcaatagacgactccatggagaagagg
catgagaagaggatacgccggatatcaattgagggaaacattgcggcgggcaaatctacc
tttctgcggcttttggatcaggagagcggggactgggaggtggtaccagagccaatcgcc
agatggtgcaatgtccaaacaaaaggcagtgactttgaggagctgaccacctctcagagg
agtggggggaatgtgttgcagatgatgtatgagaaacctgagaggtgggcctacaccttc
cagagctacgcctgcatcagcagagtgcgcgctcagatcacgtcggccaatgggaagctg
cgggaagccgagaaccctgtgcagttcttcgagcgctccatctacagcgacaggtacatc
tttgcagccaacctgtatgagagcgagtgcctgaacgagacggagtggtccatctatcag
gactgccacgggtggctgcacagccagtttggaaagcacatcgagctggacggtatcatc
tacctcagagcggccccggagaaatgtttgcagcggttgcatctgagaggcagagaagaa
gagcaagacatccctctggagtatctggagaaactccactttaagcacgagagctggctg
cggcacaagaccatgagaacggattttgagtatctcaatgatgtgcccgttctgaccata
gatataaatgaagactttaaaggaaacaacagcaagagcgctgacatgattgagaaggtc
aaggagtttttgagcactttgtag

DBGET integrated database retrieval system