KEGG   Notothenia coriiceps (black rockcod): 104952469Help
Entry
104952469         CDS       T04920                                 

Gene name
cacng5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04260  Cardiac muscle contraction
ncc04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104952469 (cacng5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104952469 (cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    104952469 (cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ncc04040]
    104952469 (cacng5)
Ion channels [BR:ncc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104952469 (cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 DUF4064 MFS_1 DUF716 DUF202 DHHC DUF4131
Motif
Other DBs
NCBI-GeneID: 104952469
NCBI-ProteinID: XP_010777591
Position
Unknown
AA seq 215 aa AA seqDB search
FASGEEKGRCFTIEYMMPTSIQMTSDSTISVLKMIRSSTPFPLVSLFFMFIGFVLSNIGH
IRPHRTILAFISGIFFILSGLALVVGLVLYISNINDEMLNRTKTNEAYFIYKYGWSFAFA
AISFLLTEAAGVMSVYLFMKRYTAEEMYRPHQGFYRPRLSNCSDYSGQFLHPDAWAGRGR
SASSISSEASLQMNAASYPALLKCPEYEQVSSSPC
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
tttgcttcaggtgaggagaaaggccggtgttttactattgagtacatgatgcccactagc
atccagatgacctctgattcaacaatcagtgtcctgaagatgatccgctcgtccacaccc
tttcctctggtcagcctcttcttcatgttcatcggttttgtactcagcaacatcggccac
atccgacctcaccgcaccatcctggccttcatttctggaatcttcttcatcctgtcaggt
ctcgctctggtggttggtctggtgttgtacatctccaatattaatgatgagatgttgaac
agaaccaaaaccaatgaggcttatttcatctacaagtatggctggtcatttgcctttgct
gccatctccttcctgctcactgaggctgcaggagtcatgtcggtgtacctgttcatgaag
cgctacacagcagaggagatgtaccggcctcaccagggcttctaccggccgcgcctcagc
aactgctccgactactccggccagttcctccacccggacgcctgggctgggcgcggacga
agcgcctcctccatctcctccgaggcctcgctccagatgaacgccgccagctaccctgct
ctcctcaagtgtcccgagtacgaacaagtgtcctcctcaccgtgctga

DBGET integrated database retrieval system