KEGG   Notothenia coriiceps (black rockcod): 104952759
Entry
104952759         CDS       T04920                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104952759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104952759
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    104952759
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 104952759
NCBI-ProteinID: XP_010777936
Position
Unknown
AA seq 1070 aa
MKAEEFSCDIMAPDIHEERQYRCEDCEQLFESRSQLLDHQKQPCGTPPSSFLNPEGDSDL
LDQEPEDLRSLHMSHGLHECKECDQVFPDVQSMEAHAMSHSDDREYKCDQCPKAFNWKSN
LIRHQMSHDNGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLK
QHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHR
RFCEGKNHFTAGGLFAQGMPLSGAPGLDKSALAMGHGVVGLADYFGASRHHSGLTFPAAP
AFPFSFPGLFPSGLYHRPQLIPASSPLRHPLHAPLPGPELNKSPLLAPSPGLQESRELLK
ALRKDGGGHMAGSERHGQSSSSSTKQRNKQSDQSESSDLDDVSTPSGSDLESTSGSELES
DMDSERERGAARENGKGPKRKASEGGPQSPSLTGSSAAKDLPGPSLIPPSLDEHTAVTGA
VNDSIKAIASIAEKYFGSAGLAGLQEKKVGALPYPSMFPLPFFPAFSPPVYPFPDRDLRP
VGLKVEPQSPAEDNKAQGKAATAFDLTTKRKMEKPATFAPSKPGASRSSGQDQPLDLSLG
GRGRGGREEETRGNMGCEEEKAVVEIPKADTSLQHARPTPFFMDPIYRVEKRRMSDPFET
LKDKYMRPAPGFLFHPQFRLPDQRTWMSAIENMADKLETFGSLKPESGDLLRSVPSMFDF
RAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYKCKYCDRSFSISS
NLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGAAMSSPFARTXRXAA
PYWLRAKEDSIXXNQNFISNTGRXQTAPASPSEEGLNGGPFEEEKPLMASRGSRDLEDEE
AEDLGADEEEGEEPGSLPGKQEDEALPSSLADDIIQDEMDFSGPNDLNLNCKTSPRRYKE
EEEEEEEEEEEQSYSALDHIRHFSDMRKLDESEMSDGDGDEDDGSFGSPSLADAVKQPLF
RKSKSQAYAMMLSLAEKDSLHPASHTPATMWHSLARAAAESSAIQSLSHV
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgaaggctgaagagttttcatgtgacatcatggctcctgatattcacgaggagaggcag
taccgctgtgaggactgtgagcagctctttgagtcccgcagccagctgctggaccaccag
aagcagccgtgtgggacgcccccctcctccttccttaacccagaaggggacagtgacctg
ctggaccaagaacctgaagacctgcgatccctgcacatgtcccacggcctacacgagtgt
aaggagtgtgaccaggtgttccccgatgtccagagcatggaggcccacgctatgtcccac
tctgacgacagggaatacaagtgtgaccagtgtcccaaggcctttaactggaagtcaaac
ctgatccggcatcagatgtcgcacgacaatggcaagcactacgaatgtgaaaactgctca
aagcaggtgttcacagaccccagtaacctgcagaggcacatccgctctcagcatgtgggg
gcgcgggcccacgcctgccccgactgcggaaagacttttgcaacatcttcaggcctcaag
cagcataagcacatccacagcagtgtcaagcccttcatgtgcgaggtctgccacaagtcc
tacacccagttctctaacctgtgccgccacaaacgcatgcacgctgactgccgcacacag
atcaagtgtaaggactgtgggcagatgttcagcaccacgtcctccctcaacaagcaccgg
cgcttctgtgaagggaagaaccatttcacagcggggggcttgtttgcccagggtatgccg
ctctctggcgccccaggtctggacaaatctgctctggcgatgggccacggcgttgtgggg
ctggctgattactttggggctagccgccaccacagcgggctcaccttccccgccgcacca
gcgtttcccttcagcttccccggcctcttcccctctggactctaccaccggccacagctc
attcccgccagctctcctctcagacatcctctccacgcaccgctcccggggcccgagctg
aacaagagccctcttctggctccgagccctggccttcaggagtcccgagagctcctcaag
gctctacgtaaagatggcggcggtcacatggcaggatcggagcgccatggccagagctcc
tcgtcctccacgaagcagcggaacaagcagagcgaccagtcggagagcagcgacctggac
gacgtcagcacgcccagcgggagcgacctggagagcacatcgggctccgagctggagagc
gacatggacagtgagagggagaggggggctgctcgagagaatggcaaaggccccaagagg
aaggccagtgaaggaggccctcagagccccagcctgacaggcagcagtgctgccaaagac
ttaccgggcccctccctcatcccaccctcgctggacgagcacacggctgtaacaggcgct
gtgaatgactctattaaggccatcgcttccattgccgagaagtactttggctccgcgggg
ctggccggcctgcaggaaaagaaggtgggcgctctgccctacccctccatgttcccgctg
cccttcttcccagctttctctcccccagtttacccttttccagacagggacctcagacct
gtaggcctgaaggtcgagcctcagtctccagctgaggacaacaaggcccagggcaaggct
gccacagcgtttgacctcaccaccaagcggaagatggagaaacctgccacgtttgccccc
tccaaacccggggcctcccgctccagtgggcaggaccagcctctcgacctgagcctgggg
ggccggggtcgtggaggcagagaggaggagacgagggggaacatggggtgtgaggaggag
aaggccgtggtggagatcccgaaagctgacacctctttgcagcacgccaggcccaccccc
ttcttcatggaccccatctacagggttgagaagaggaggatgagcgatccgtttgagact
ctgaaagacaagtacatgcgaccagcacccggcttcctgttccatccacagtttcgtttg
ccagatcagagaacttggatgtcagccatcgagaacatggcggataagctggagacgttt
ggctccctgaagccggagtccggcgacctgctgcgctccgtcccctccatgtttgacttc
cgagcccccccctccgcactaccagagacgctgctgcgcaagggcaaggagcgctacaca
tgcagatattgtggaaaaatattcccacgctctgccaacctgacccgccacctcaggact
cacacaggagagcaaccgtataagtgtaaatactgcgaccgctccttcagcatctcctcc
aacctgcagcgccacatccgcaacatccacaacaaggagaagcccttcaagtgccacctg
tgtgaccgctgcttcggccagcagaccaacctggaccgccacctcaagaagcacgagaac
ggaaacctgtcgggcgctgcgatgtcgtcccccttcgctcgaacgtgacggtaagcggcg
ccatattggctaagagcaaaggaagactctatttaatgaaatcagaacttcatcagcaac
acaggcagangccagacggctcccgcgagcccctcagaggaagggttaaacggcggccca
ttcgaagaagagaagccgctgatggcgagccgcgggtcacgtgacttggaagacgaggaa
gcggaggacctcggggctgatgaagaggaaggagaagagccgggcagcctccctgggaaa
caggaagacgaggcacttcccagcagcctcgctgacgacatcatacaggacgagatggac
ttcagcggacccaacgacttgaacctcaactgcaaaacctctcctcggaggtataaagag
gaagaggaggaggaggaagaggaggaggaggagcagagctactcagccttggatcatatc
cgtcacttttctgacatgcgcaagctggatgagagcgagatgagcgacggggacggagat
gaggacgacggatcgtttggctccccgtcgctcgctgacgctgtcaaacagccgctcttt
aggaagtctaagtctcaggcgtacgccatgatgctgtccctggctgagaaggactccctc
cacccggcctcccacaccccggccaccatgtggcacagtctggcccgggcagctgctgag
tccagtgccatccagtccctgagccacgtatga

DBGET integrated database retrieval system