KEGG   Notothenia coriiceps (black rockcod): 104953405Help
Entry
104953405         CDS       T04920                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04020  Calcium signaling pathway
ncc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104953405
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104953405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ncc04030]
    104953405
G protein-coupled receptors [BR:ncc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104953405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 TAS2R
Motif
Other DBs
NCBI-GeneID: 104953405
NCBI-ProteinID: XP_010778652
Position
Unknown
AA seq 191 aa AA seqDB search
MNSSIEQRRHSEGSNSTSCIFMVNKPYALTCSVVAFYIPLVLMVLAYQRIYITARAHALQ
ISILQRAGGGGGGGIDHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIDYA
VPEQLWIACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGRKRYRRPSILGSGAPCTA
TQINGSTHVVK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctcaatcgagcagcggcgccacagtgagggcagtaactccacctcctgtatc
ttcatggtgaacaaaccgtacgccctcacctgctccgtggtggccttctacatcccgctg
gtcctcatggtgctggcctaccagaggatctacatcacggctcgagcccacgccctgcag
atcagcatcttgcagcgagcgggaggaggtggaggaggtgggatagaccatcaacgaaac
caccgcatgcgaacagagaccaaagcagccaagactctgtgcatcatcatgggttgcttc
tgcctctgttgggcgccgttcttcgtcactaacgtggtggacccctttatagactacgcg
gtgccggagcagctgtggatcgcctgcctgtggctgggatacattaactccatgctcaac
cccatcctctacgccttcctcaacaagtccttccgccgtgccttcctcatcatcctgtgc
tgcgggaggaagaggtaccgccggccgtccatcctggggtccggagcgccctgcacggcc
acgcagatcaacggctccacacatgtagtcaagtaa

DBGET integrated database retrieval system