KEGG   Notothenia coriiceps (black rockcod): 104954428
Entry
104954428         CDS       T04920                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00100  Steroid biosynthesis
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104954428
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104954428
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 104954428
NCBI-ProteinID: XP_010779836
UniProt: A0A6I9NZU5
Position
Unknown
AA seq 242 aa
MDALGNNTVPSTPLNRRPIMKRNSQGLKQRPSHDTEREFGGTLGALCIPILLPLTVMFLI
CVSRSPEASLLQWPPALPSTDQLWDPLAPVLLLGWISLHALLYVLPLGKVSEGLVLRNGT
RLKYPINGFHSLCISGVLLMLLLGLGAPLGSLFELLLPLAACAIAGSYLFSLYLYIRSFW
VPSHALALGGNTGNPLYDFFIGRELNPRIGNFDLKYFCELRPGLIGWVSHPAGQHGQFTS
RY
NT seq 729 nt   +upstreamnt  +downstreamnt
atggatgcattgggaaataataccgtcccatctacacctctaaaccggagaccaataatg
aagcggaacagtcaagggctcaaacagagaccctcacatgacacagaaagggagtttgga
gggaccctgggtgcattatgcattcccatcctcctgccgctgacggtgatgttcctgata
tgtgtgagtcgatcccctgaggccagtttgctccagtggccccctgccctcccctccact
gaccagctgtgggaccctctggcccctgtgcttctgctgggctggatctctctgcatgcc
ctcctctatgtgttgccattaggaaaggtgtctgaaggattagtgctgaggaatggaacg
cgtctcaagtatcccatcaatggtttccacagcctgtgcatcagcggtgtgttgctgatg
ttgttgctggggctgggggctcctctggggtctctgttcgagctgctgttgcctctggcg
gcgtgcgcgatagcggggtcatacctgttctccctctacctctacatccgctccttctgg
gttccttctcatgctctcgctttgggaggcaacacgggaaatccactttatgacttcttc
atcggaagagagctaaacccccggattggaaactttgaccttaaatatttctgtgagctg
cgaccgggtctgattggctgggtgagtcatcctgcaggacagcacggtcaattcacatcc
cgatattaa

DBGET integrated database retrieval system