KEGG   Notothenia coriiceps (black rockcod): 104954446
Entry
104954446         CDS       T04920                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104954446
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     104954446
Peptidases and inhibitors [BR:ncc01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   104954446
SSDB
Motif
Pfam: ADAM_CR_2 TSP_1 Reprolysin Reprolysin_3 Reprolysin_5 TSP1_spondin TSP1_CCN Reprolysin_4 ADAM_spacer1 Reprolysin_2 TSP1_ADAMTS Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 104954446
NCBI-ProteinID: XP_010779851
UniProt: A0A6I9NZW6
Position
Unknown
AA seq 719 aa
MTSPLEEVGGKLRANRSTALSHHSSKQRDIVSSPGSSPDTSGTQAEYSCMSILCFLQFTV
SGRLPRSTLMPDITHLELLVVVGPDVQQIHKQDTERYILTNLNIASELLRDMALGANMRV
HLVRMIILSEPEPEIQMSPNITSSLRSVCDWGRRINPSNDTDPLHADLLLYITRYDLVLP
DGNKQVRGVAQLGGACSSEWSCVITEDTGFDLGITITHEIGHSFGINHDGVGNTCSRSGF
MMASDGGYNSVDLTWSPCSREQLLTFFREGKAECVTDLPSLGGSLQDWKPGLYYGVDDQC
RIAFGSTARACSFTNPDLPTCRVLSCHLHPDDDSSCKRLLVPLLDGTECAPNQWCLKGRC
VSADELSSSVVVHGSWSNWSEFSPCSRTCGGGVSHRTRKCNNPRPAFGGDDCEGPDIEAG
LCHQQPCEQMQLDFMAEQCSQTDLHPLYLLPNTASFYTWIPAIGFGQGAEQCRYMCQSKG
EHFLVSRGSQFVDGTRCESDSPPQYGSRATCLRGKCQLFGCDGVLHSGKVMDVCGVCGGG
GSSCTLTSDSYTGGQAREYTTFLSLPVNATQVHIVNRSPLFTHMAVRVGDRYIVSGTSSM
ALSMTHPSPLEDHHLEYRLHLTPDLLPEMEELLLPGPLTEEINVQVYRKYGKEYGEKTNP
NISYQFYLPNRNSDLIEIHPKGKWAVFTAPCSVSCGSGERLFIMSHIEKNKDKTEKNIC
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgacttctccattggaagaggtaggtggaaaactgcgggcgaacaggagcactgcgctt
tctcatcactcctctaaacaaagagacatcgtttcctctcctggttcttctcctgatacc
tcaggtacacaagcagagtactcctgtatgtccatactttgttttctccaattcacagtg
agtgggcggctgcctcggtcgactctgatgcctgacatcacacatctcgaactgctggtg
gttgtagggcctgatgtccagcagatccacaagcaggatacagaacggtacatcctcacc
aacctcaacattgcctcagagctgttgagagacatggcccttggcgccaacatgagggtg
cacctggtccgcatgatcatcctgtcagagccagagccagagatccaaatgtctcccaac
attacctcctctctcagaagtgtttgtgactggggcagaaggataaacccctcaaatgat
acagacccacttcacgctgatcttctgttatacattacaaggtacgacctggtgttgcct
gatgggaacaagcaggtcaggggtgtagcacagctggggggggcttgctccagtgaatgg
agctgtgtgatcacagaggacacaggctttgacctagggatcaccatcactcatgagatt
ggccacagttttggaataaaccatgacggagtaggaaacacctgcagcaggagtgggttc
atgatggcctctgacgggggctacaacagtgtggatctgacctggtcgccctgcagcaga
gagcagctgctcacattcttcagagaaggaaaagctgaatgtgtgacggacctgccttca
ctgggaggctctctacaagactggaagcctggcctgtattatggagttgatgaccagtgc
cgtatagcttttggtagcactgcaagagcctgttctttcactaatcctgacctgccaacg
tgtcgtgtcctgtcctgtcaccttcaccctgatgacgacagctcctgcaaacgtctcctg
gtccctctgctggacgggacagagtgtgcacctaatcagtggtgtctgaaggggcgttgt
gtgtcggctgatgagctcagctcctcagtggtggtgcatggctcctggtccaactggtct
gagttctccccctgctcccggacatgtggcgggggagtctctcaccgcacacggaaatgc
aataacccaagaccggcttttggaggggatgattgtgagggaccggatattgaggctgga
ctttgtcaccagcagccatgtgagcaaatgcagcttgatttcatggcagagcagtgttcc
caaacagacctccaccccctctacctgctaccaaacaccgcctctttctacacctggatc
cctgctataggatttggacaaggggcggagcagtgcagatatatgtgccaatcaaaagga
gaacatttcctagtgagccggggctctcagtttgtggatgggactcgctgtgagtcagac
agcccgcctcaatatggctccagagctacatgtctcagagggaaatgccagctgtttggc
tgtgatggtgtgctgcattctgggaaagtgatggatgtgtgtggggtatgcggtggaggc
ggatcatcctgcactttgacctctgactcctacactggtggtcaggctagagagtacacc
accttcctctctctgccggtgaatgccacacaggttcatattgtcaacagatcacctctg
ttcactcatatggctgtaagggttggggatcggtacattgtgtccgggacaagcagcatg
gccctgagtatgacccacccctccccactggaagaccaccatctagagtaccgcctccac
ctgacccccgaccttttgcccgagatggaggagctgctgcttccagggccgctgacagaa
gagataaacgtacaggtgtatcgcaaatatggaaaagaatacggagagaaaacaaatccg
aacatcagctaccagttctatttacctaacagaaacagtgacttgatagagatccaccct
aaaggcaaatgggcggtcttcacagcgccgtgctctgtctcctgcggctctggtgagagg
ctgtttattatgagtcatatagaaaagaacaaagacaaaacagaaaaaaatatctgctag

DBGET integrated database retrieval system