KEGG   Notothenia coriiceps (black rockcod): 104954534Help
Entry
104954534         CDS       T04920                                 

Gene name
nit1
Definition
(RefSeq) nitrilase homolog 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104954534 (nit1)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     104954534 (nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 104954534
NCBI-ProteinID: XP_010779948
Position
Unknown
AA seq 318 aa AA seqDB search
MFTARCILGTSAKYLTSLPAPRQQIKLQNRMSTLLRPVAAVCQVTVTPDKKANFSACKQL
VEEAKGRGASMVFLPEAFDYIGSSREETLSLSESLTGDTISQYSQLARKLEVWLSLGGFH
ERGHNWESDRRIYNSHIIINDKGEIVSVYRKSHLFDVELPEKGVSLKESAFTIPGPSLVS
PVQTPIGKVGLGICYDLRFPDLSLALQRQGADILTYPSAFTVATGAAHWEVLLRARAIET
QCFVLAAAQVGRHHEKRSSYGHALAVDPWGEVLGDCGGEKPGMVLVEIDLEKVSSTRRNM
PVQQHRRNTDFYQSLEKS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcacggccaggtgcattttgggaacatctgcaaagtatttgacctctctcccagct
ccgagacaacagatcaagctccaaaacaggatgtcgaccttacttcgcccggtggctgca
gtgtgtcaggtgaccgtcaccccggataaaaaggctaacttctccgcctgtaaacagctg
gtggaggaggccaaggggcgaggggccagcatggtcttcctgcccgaggccttcgattac
atcggatccagccgagaggagacgctgtcgctgtctgagagtctgacaggagacacaata
tcacaatactctcagctggccaggaagttggaagtgtggctgtctcttggaggatttcat
gaacgaggacataactgggagtctgacagacgaatctacaacagtcacatcataattaac
gataaaggtgaaatcgtttcagtctacaggaagtcccatttatttgacgtggagctgcca
gaaaaaggcgtatcacttaaagaaagtgccttcaccatccctggaccctccctcgtgtct
ccagtccaaactcccatcggcaaggttggcctgggcatctgctatgatctgaggttccca
gacttatcactggctctgcaaaggcaaggcgctgatattcttacctacccatcagccttc
actgtagccacaggagctgctcactgggaggtgttactgcgtgcacgggcgatagagact
cagtgtttcgtcctggcggcggcgcaagtcggccggcaccacgagaagcgctcgtcgtac
ggccacgccctcgccgtggacccctggggtgaggtgctgggagactgtggaggggagaag
ccaggcatggtgctggtggagatcgacctggagaaggtcagcagcaccaggaggaacatg
ccggtccaacagcaccgcagaaacactgatttttatcaaagtctggagaagagttga

DBGET integrated database retrieval system