KEGG   Notothenia coriiceps (black rockcod): 104956322Help
Entry
104956322         CDS       T04920                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04218  Cellular senescence
ncc04370  VEGF signaling pathway
ncc04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104956322
   04370 VEGF signaling pathway
    104956322
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104956322
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104956322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104956322
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104956322
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   104956322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104956322
NCBI-ProteinID: XP_010782103
Position
Unknown
AA seq 382 aa AA seqDB search
MSSQIQPAVPIQQQPNLNSAPFPPHYFVNTLNNLLQIKRNVITVDYNVTSQVLGMGINGK
VLEIFHKESGEKYALKMLQDCPEARREVELHWRVSTCHHIVPIIDVYENLYHGRKCLLIV
MECMDGGELFSHIQDRGNHAFTEREASDIMKSIGEAIHFLHFINIAHRDIKPENLLYTSK
RPDAFLKLTDFGFAKEITTLNSLATPCFTPYYVAPEVLGPEKYDRSCDMWSLGVIMYILL
CGYPPFFSHHGLAISPGMKRRIRTGKYDFPKPEWSDVSDEAKQLICHLLKTEPTQRMNIT
EFINHPWINQSVEVPLTPLHTSRVLHEEQDVWEKVKEEMTNALQTMRVDYDQIKIKTIED
STNPLLLKRRKKSKKPPTQPPG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtcagatccagccggctgtgccgatccaacagcagcctaatctaaactctgct
cctttcccacctcactattttgtgaatactctaaacaaccttcttcaaatcaaaaggaat
gtaattacagtcgattacaatgttacaagtcaggtgctcgggatggggataaatggcaag
gtgttggaaatatttcacaaagagagtggagaaaagtatgcactgaagatgctgcaggat
tgtcctgaggccaggcgggaagtggagctccactggagggtgtcaacttgtcaccacatt
gtacccatcatagatgtttacgagaatctctaccatggcaggaagtgcctcctcatcgtg
atggaatgtatggatggaggtgaattgtttagtcatatccaggacagagggaatcatgca
tttacagaaagagaggcctctgacatcatgaagagtataggagaagccatacatttcctg
catttcatcaacattgctcacagagacatcaagccagagaacctgctgtacacctccaaa
aggccagacgccttcctcaagctgacagattttgggtttgccaaagaaatcaccacctta
aactctctggcaacaccatgttttacaccctactatgttgctccagaggttctgggtcca
gagaaatatgacagatcctgtgacatgtggtctctgggtgtcattatgtatattctactt
tgtggttaccctcccttcttctcacatcacggtttggcaatatccccaggaatgaaaaga
cggatccgtactggaaaatacgatttccccaaaccagaatggagcgatgtgtctgatgaa
gccaaacagctaatttgccacttactgaaaactgagccaacccagagaatgaacatcaca
gagttcataaatcatccctggattaatcagtcagtggaggtcccactaacacctctccac
accagccgcgtgctgcatgaggagcaagatgtctgggagaaggttaaggaggaaatgaca
aatgccctgcagacgatgagagtggactatgatcaaataaaaatcaaaaccattgaagac
tcgactaatcctctactcttgaagagaagaaagaaaagtaaaaaaccacccacacaacct
ccaggctag

DBGET integrated database retrieval system