KEGG   Notothenia coriiceps (black rockcod): 104956666Help
Entry
104956666         CDS       T04920                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00010  Glycolysis / Gluconeogenesis
ncc00562  Inositol phosphate metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104956666 (minpp1)
   00562 Inositol phosphate metabolism
    104956666 (minpp1)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104956666 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104956666 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 104956666
NCBI-ProteinID: XP_010782491
Position
Unknown
AA seq 460 aa AA seqDB search
MTFFWKFTVIHVLIIPCCVVNYVIPEDNFDIPSIAKYFNTKGRYEEVNPHLIKDIFAVNR
SILQPPSAQCQPFHLTAIIRHGTRYPTSKNAKEMQQLYNMVMSSASGKESWLREIKSQWR
MWYTEDMDGRLVQKGVEDHKHLAIRLSKLFPSLISEEKLRGGFIKFITSSKHRCVNSTLS
FKAGLTELWAITDKEFDHAVNDALMRFFDHCARFVQEVDKNPTALSEVDKFRQGPEMRRV
TEKIADRLRVPYNTINDDMAEAAFYLCAYEFAIKTVNSPWCQLFDEVDAQVMEYANDLKQ
FWKRGYGYDINSKSSCILFHDVFSRLNRAADENRSGQQMTEAVTVQVGHAETLLPLLTLL
GFFKNNGSITSTNYATQTQRSFRTSHMLPYAANLLLVLYDCGAGDLRLQALLNEQPVTFP
GLSDQQAPMPRYEDVKENYSELLQACDLSTGCQPIKKILA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacttttttttggaagttcactgtcattcatgtcctcatcatcccctgctgtgtagtt
aattatgtaattcctgaggacaattttgacataccatcaatcgccaaatatttcaacaca
aaagggaggtatgaagaagtgaacccgcatctcataaaggacatattcgctgtaaacaga
tctatcctgcagcctccatctgcacaatgtcaaccatttcatctgacggcgataataaga
cacggcacgaggtacccgacgagcaaaaacgccaaggagatgcagcagctctacaacatg
gtcatgagcagcgcctcgggcaaagagagctggctgcgggaaatcaagagccagtggcgg
atgtggtacactgaggacatggacggcagactggtgcagaaaggtgtggaggatcacaag
catctggccatcaggctgtcaaagctgttcccctctctgatctcagaggagaagctccga
ggaggattcatcaaattcataaccagctcaaagcacaggtgtgtcaacagcacgctgtcc
ttcaaggcaggactgacagagctgtgggcgattacagataaggagtttgaccacgcagtg
aatgatgctctcatgaggttctttgaccattgcgccaggtttgtgcaggaagttgataag
aaccccacagctctgtcagaggtggacaagttcagacagggaccagaaatgaggagggtc
acggagaagattgcagacagactcagagtcccctacaataccatcaatgacgatatggcc
gaagctgcattttatttgtgtgcttatgagtttgccatcaagaccgtgaactccccctgg
tgtcagctttttgatgaggtggatgcacaggttatggagtatgccaacgacctaaagcaa
ttctggaaaagaggttacggttatgatattaacagcaaatcgagctgcattctcttccat
gacgtgtttagtcgactgaacagagcagccgatgagaacaggtcaggtcagcagatgact
gaagctgtgacagtccaggtgggccatgcagagaccctcctgccactgctcactcttctg
ggcttcttcaagaacaacggatcaatcacttccaccaactacgccacacagacccaacgc
tccttccgcaccagccacatgttgccctatgcagctaacctcctcctggtgctgtacgac
tgtggagccggagacctgaggctgcaggcgctgctcaacgagcagcctgtgactttcccc
gggttgagcgaccagcaggcccccatgcctcgatatgaagatgtcaaagagaactacagc
gagctgctccaagcctgtgatttgagcactgggtgtcagcctattaaaaaaatccttgcc
taa

DBGET integrated database retrieval system