KEGG   Notothenia coriiceps (black rockcod): 104957359Help
Entry
104957359         CDS       T04920                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC8
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104957359
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104957359
Membrane trafficking [BR:ncc04131]
 Protein recycling
  Others
   GRIP associated proteins
    104957359
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 104957359
NCBI-ProteinID: XP_010783282
Position
Unknown
AA seq 346 aa AA seqDB search
IVMPDERKTSAILEEGVRGHDYRSEPNLDLPEYTNAPLHRTFQSSPHQLDSDPLTSRSLS
LKQGQPQTLTSTPYKSVFSPNTLSNRNGSLSYDSLLNPSISPAAPPSECVSHRGIPSSGF
HSPYLPTKMCHIRETDMQRHQVSSAYSPVMHQRAVGRQPSPHLRDRDPSPVRYDNLSQTI
MASIQERKDMEEREKRQIIHGRSQTHIYAQDSGVFDGGYGLPPSVCYPDGPRGSLSRGPT
PPAYGGSRDNLMGVGLVSYGQRAPALRSTLGRAPRTSSTSLHTDHSSSNSSQSRAGPPEG
LYRSPAHQPHSPAMPRSPSYSHQKLSYISALERTDSPRLGGPRYET
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
attgtcatgccagatgagcggaagacctcggccatcttggaagagggcgtccgcggtcac
gactaccgatccgagccgaacctggacctgccggagtacaccaacgccccgctccaccgc
accttccagtcctccccccaccaactggactccgaccccctgacctctcgctccctcagc
ctgaagcagggtcagccgcagaccctcacctccaccccgtacaagagcgtcttctccccc
aacacgctgtccaaccgtaacggcagcctctcctacgacagcctgctgaaccccagcatc
tctccagcggccccccccagcgagtgcgtgtcccaccgcgggatcccctccagcggcttc
cactcgccctacctgcccaccaaaatgtgccacatccgggaaacggacatgcagaggcac
caggtttcctccgcctacagtccggtgatgcaccaaagagcggtgggccggcagccctcc
cctcacctgcgggaccgcgacccgtcccccgtgcgctacgacaacctctcccagaccatc
atggcctccatccaggagcggaaggacatggaggagcgggagaagaggcagattattcac
gggcgctctcagacccacatctacgcccaggactctggcgtgtttgacgggggttacggt
ttacccccgagtgtttgctacccggacgggcctcgtggctccctctccagaggccccaca
ccccccgcctacggagggtcccgggacaacctgatgggggtcgggctggtgagttatggg
cagcgagccccagcgttacgctccacgctgggccgcgcccccaggacttcctccacctcc
ctccacacggatcatagtagcagcaacagcagccagagcagggccggcccccccgagggt
ctctaccgctccccggcccaccaaccccactcccccgccatgccccgatccccctcctac
tcccaccaaaaactctcctacatcagtgccctagagaggacagactcccctcgtctgggg
ggcccaaggtatgaaacctaa

DBGET integrated database retrieval system