KEGG   Notothenia coriiceps (black rockcod): 104957984Help
Entry
104957984         CDS       T04920                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 15-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04060  Cytokine-cytokine receptor interaction
ncc04068  FoxO signaling pathway
ncc04210  Apoptosis
ncc04217  Necroptosis
ncc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104957984
   04068 FoxO signaling pathway
    104957984
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104957984
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104957984
   04217 Necroptosis
    104957984
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104957984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncc04147]
    104957984
   04052 Cytokines and growth factors [BR:ncc04052]
    104957984
   04090 CD molecules [BR:ncc04090]
    104957984
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104957984
Cytokines and growth factors [BR:ncc04052]
 Cytokines
  Tumor necrosis fators
   104957984
CD molecules [BR:ncc04090]
 Proteins
  104957984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 104957984
NCBI-ProteinID: XP_010783969
Position
Unknown
AA seq 226 aa AA seqDB search
MINTYQTSVAAPPVPPRLSRSQQVLFPAPSQGHSKSLLRFLTGVVVLHLFLSVGGFIYLK
QNDTMHPSQLPSAEGKTAHRSSGKQETSNKALARMVVKKSDQKGAGYLEWDMGHSVLKSV
SYSHKMWLTIEQPGDYYVYSRVTFSKLDPKRPLVSIVKLRESEKGKEKTVMQAFCNMDSS
GAPQLSTATQGELVTLEKGNQLGVWLHNLSVVSYEDGATTFGIFRL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacacttaccagaccagtgttgctgcaccgccggtgcctccacgcctcagccgg
tcccaacaggtcctcttcccggctccatcacaaggccacagcaagtctctcctcaggttc
ctgaccggtgtagtggtgctgcacttattcctttcagtcggaggattcatctacctgaag
caaaatgacacaatgcatccatcccagctcccatcagcagaaggaaaaactgcccatcgc
tcatcaggaaagcaggaaacatcaaacaaagccctggcccgcatggtagtcaagaagtca
gatcagaaaggagcgggttatctcgagtgggatatgggccactcagttttaaagagcgtc
agttactcccacaaaatgtggttgaccatcgagcagcctggcgactactacgtctactcc
agggtgaccttctccaagctcgacccaaagcggccgctggtcagcatcgtgaagctgagg
gagagtgagaagggaaaggagaagacagtgatgcaggcgttctgcaacatggacagcagc
ggtgcgcctcagctgtccacggccacacagggagagctggtcacactggagaaagggaac
cagctcggtgtctggttacacaacctttcagtggtgtcctacgaggacggggccacaacc
tttgggattttcagactgtag

DBGET integrated database retrieval system