KEGG   Notothenia coriiceps (black rockcod): 104958191Help
Entry
104958191         CDS       T04920                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00511  Other glycan degradation
ncc00600  Sphingolipid metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104958191
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    104958191
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     104958191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Bac_rhamnosid6H GDE_C Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 104958191
NCBI-ProteinID: XP_010784215
Position
Unknown
AA seq 495 aa AA seqDB search
RYTRYFGTKGDASPSLGHYALTHYRQWEKSIDEWQRPILQDSSLPSWYKSALFNELYFVV
DGGTVWTELPEDADVSGGVRSEDGGLPAQPAVVKEFGRFAYLEGQEYRMYNTYDVHFYAS
FALIMLWPKLALSLQYDIAGSVVQQDPMERLHLMSGRYSPVKAKNVVPHDIGDPDDEPWQ
RVNAYLIHDTADWKDLNLKFVLQVYRDFHLTQDHQYLKDMWPVCQAVMESEMKFDLDGDG
LIENSGYADQTYDGWTVTGPSAYCGGLWLASLCVMCKMAKLVENEEAYKRYRDILDRGSA
AYDKLLWNGKYYNYDSSGRDLSNSVMSDQCAGHWFLKASGLGEGEYQAFPKEKIQTALKS
VFDLNVMSFAGGQMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAATMIHEGMQEEGMRT
AEGCYRTVWERLGMAFQTPEAYCEKGIYRSLAYMRPLSVWAMQLALNTSQKDQTTTAQTE
ATDGEHGQDLGETQS
NT seq 1489 nt NT seq  +upstreamnt  +downstreamnt
gagatacactcgttactttgggaccaaaggggatgcttccccctcattaggtcactacgc
actaacacactacagacagtgggagaagagcattgacgagtggcaaagacccattctcca
ggacagctccctcccctcctggtataagtcggccctatttaacgagctgtactttgtggt
ggatggagggacggtgtggacggagctaccggaggacgctgatgtcagtgggggggtgcg
cagcgaggacggggggctgccagctcagcccgccgtcgttaaagagttcggacgtttcgc
ctacctagaaggtcaggagtacagaatgtacaacacatacgacgtgcacttctacgcctc
gtttgcacttatcatgctgtggcctaaacttgccttgagtttgcaatatgatattgccgg
cagtgtggttcagcaggaccccatggagaggctgcatctgatgagcgggcgctactctcc
tgtcaaggccaaaaacgtggtacctcacgacataggagacccagatgatgagccgtggca
gagggtaaatgcttacctcatccatgacactgcagactggaaggacctgaacctgaagtt
tgtgctgcaggtctacagggactttcatctcactcaggaccatcagtacctgaaggacat
gtggcccgtctgccaggcggtgatggagtcagagatgaagttcgacttggatggagacgg
ccttatagagaattctggatatgccgaccagacttatgacggctggacggttacgggacc
aagtgcgtactgtggtgggctgtggttagcgtccctgtgtgttatgtgtaaaatggccaa
actggtggaaaatgaggaggcatacaaacgctacagagacatcttggaccggggcagcgc
tgcttatgacaaactgctgtggaacggcaagtactacaactatgacagcagtgggaggga
cctttctaatagcgtcatgtctgaccagtgtgctggccattggttcctgaaagcgtctgg
actgggagagggagaataccaggcttttcccaaagaaaaaattcagaccgcactgaaatc
tgtctttgacttgaatgtaatgagcttcgctggaggccagatgggggcagttaacggcat
gcgccccgagggagtgcctgaccgctccagtgtccagtcggatgaagtctggattggagt
cgtgtatggactagcagccactatgatacatgaggggatgcaggaggagggtatgcgcac
ggcggagggctgctaccgaaccgtgtgggagcggctgggcatggccttccagactcctga
agcgtactgcgagaagggaatctaccgctctctggcatacatgaggcctttgagtgtgtg
ggccatgcagctggccctcaacacttcacagaaggatcagaccacaacagctcaaactga
agctacagatggagagcacggacaggatttgggagaaactcagagctag

DBGET integrated database retrieval system