KEGG   Notothenia coriiceps (black rockcod): 104958611Help
Entry
104958611         CDS       T04920                                 

Definition
(RefSeq) serine/threonine-protein kinase MAK-like isoform X1
  KO
K08829  male germ cell-associated kinase [EC:2.7.11.22]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104958611
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104958611
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   104958611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 104958611
NCBI-ProteinID: XP_010784658
Position
Unknown
AA seq 552 aa AA seqDB search
MSFQILQGLSFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRW
YRAPEVLLRSSTYSSPVDLWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKTDW
SEGYQLASAMNFRFPQCVPTHLKTLIPNASNEAIILMRDLLQWDPKKRPTAVQSLRYPYF
QVGQILGPRPQSQEIKKVQARPPVSESKADTQQSSSDSKASTSSSKNHHHPPQQIPLPQT
ESKAGGHAKAASLGSENSVGGGGMAELKSGRRRWGQTVAKTSDSWEESDRSETAASDSKK
PSLGDAEEEWGPQEEWGPQEERGPQEHRPQPKPSEQKPLYSFSTVTKLPNNVKMGQMDPN
LPGSAARQHYLSQSRYMPGLIGKHQTSSGDKELSGLTLRDLWENSSNTVNKPLAPIGGGL
SVTRAKAGNFVSTKYNLSGAYIPSFQKKEVGSVGQRIHLAPLAGQHKINPSSSPDNKKEK
SKSAKAKPVSNSSLSESNEDYEGLKRRADRTQMKGSSYSALGKTSGNLLSRAPPVQPVHG
RVDWTSKYGGTR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagctttcagattttacaaggcctgtcatttattcacaaacatgggttctttcatcgg
gacatgaagccagagaatctgctgtgcatgggtccagaactggtgaaaatagcagatttt
ggactggccagagagatccgctccaaacctccgtacacagactatgtttcaacccgatgg
taccgggctccagaggtcctgcttagatcgtctacctacagctctcctgttgacctgtgg
gcggtgggctgcatcatggctgagctctacactctcagacctctcttccctggaaacagt
gaagtggatgagatctttaagatatgccaagttctaggcaccgtgaaaaagacggactgg
tccgagggctaccagctagcttctgctatgaactttcgcttcccccaatgtgtgcccacc
cacctgaagaccctcatcccaaatgccagcaacgaggccatcatactgatgagggacctg
ctgcagtgggaccccaaaaaaagacccactgctgtacagtccctgcgttacccatacttc
caggtaggccagatcttagggcctcgacctcagagccaggagatcaagaaggtccaggcc
aggccgccggtctcggagtccaaggctgatacccagcagtcttcctctgactccaaagcc
tccacttcctcctccaaaaaccatcatcatcctcctcagcagatcccccttccccaaact
gagagtaaagcaggaggtcatgcaaaagctgcatcgctgggcagtgagaacagcgttggt
gggggggggatggcggagctgaagagcggccgtcgtcgctggggccagaccgtcgccaag
acctcagacagctgggaggaatcggaccgctcagaaaccgccgcctccgactccaagaag
cccagcctgggggacgcagaggaggagtggggccctcaggaggagtggggccctcaggag
gagaggggccctcaggagcatcgcccacagcccaagccgtcggagcagaagcctctgtat
tccttcagcacagtcactaagctacccaacaatgttaagatgggccaaatggaccccaat
ctcccaggatctgctgcacgacagcactacctgagccagtctcgatatatgccagggttg
atcggcaagcatcagacttcttctggcgataaggagttgagtggtttgacgctgcgggac
ttgtgggagaactcctcaaacactgtaaataaaccgctcgctcctattggaggaggatta
tcagtcacgagagccaaagcagggaactttgtgagcaccaaatacaacctctctggcgct
tatattccttcattccagaagaaagaggtgggctcagtggggcagagaatccatctcgct
cctttggctggtcagcacaaaatcaatccttcctcttctcctgataacaaaaaagagaaa
tctaaatctgcaaaggccaagcctgtatccaactcctctttgagcgaaagtaatgaagat
tacgagggcttgaagaggagggcagacaggactcagatgaaggggagcagctactcagcc
ctggggaagacttctgggaatctccttagccgagccccccccgtgcagccggtccacggc
agagtggactggacatccaaatatggtggaactcggtag

DBGET integrated database retrieval system