KEGG   Notothenia coriiceps (black rockcod): 104959010Help
Entry
104959010         CDS       T04920                                 

Definition
(RefSeq) myosin light chain kinase family member 4-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04020  Calcium signaling pathway
ncc04270  Vascular smooth muscle contraction
ncc04371  Apelin signaling pathway
ncc04510  Focal adhesion
ncc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104959010
   04020 Calcium signaling pathway
    104959010
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104959010
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104959010
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104959010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104959010
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     104959010
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104959010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like ALGX
Motif
Other DBs
NCBI-GeneID: 104959010
NCBI-ProteinID: XP_010785155
Position
Unknown
AA seq 516 aa AA seqDB search
TSSFNEPVLQEQLEKLNRQNTEHSHGKAEADNQRGEGGGSGGKRQESAEPILNGQFTAEA
ESEDRKKDTHWKEEGGDLFQDSESDEVEEKVEDVSPEQTVEDDGNTKHKGEAEESSTLDK
ASLSPQESSEEVSDVATCSKRRVTEEDLVKDDLKKSRVEDEEGKNAEVAEEGAAQASKSE
EVKTEVEEEGKEGESAEKEFLLDVSPPPQAPFDHRIVTPKPHQISSYYTINRDEVLGGGR
FGQVHKCIENSSNLMLAAKIIKARSQKEKDLVRNEIQVMNQLNHPNLIQLYAAFESRHDI
ILVMEYVEGGELFDRIIDENYNLTELDTVLFIRQICEGLQYMHKMYILHLDLKPENILCV
SRATNKIKIIDFGLARRYKPREKLRVNFGTPEFLAPEVINYEFVSFPTDMWSLGVIAYML
LSGLSPFLGDDDNETLNNILACQWNFEEEEFKDISDEAKDFITLLLVKSKSWRMSAAESL
RHPWLSDRSLHYRLDQKKNKCHSTHAPSPENQTETL
NT seq 1553 nt NT seq  +upstreamnt  +downstreamnt
aaacgtcctccttcaatgagccggtgctgcaggaacagttggaaaagctcaacaggcaga
acactgagcattcccatggaaaagcagaggccgacaaccagaggggggaggggggaggaa
gtggagggaaaagacaggagtcggcagagccgatcctgaacggacaattcaccgctgagg
ccgagtcagaggacaggaagaaggacacacactggaaagaggaggggggggatctcttcc
aggactcagaatcagatgaagtggaggaaaaagtagaagatgttagtccagaacagactg
tggaggatgatgggaatacaaagcataaaggagaggcagaagagtcatcaacattggata
aagcctctctctcaccacaggaaagctctgaggaggtcagcgatgtggccacttgcagca
aacgtcgtgtcactgaagaagacctggtgaaggacgacctcaagaaaagcagagtggaag
atgaggaagggaaaaacgctgaggtggcagaggaaggagcggctcaagcctccaaatctg
aagaagtaaaaactgaggtggaagaggaggggaaggagggagagtcagcagagaaggaat
ttcttcttgacgtaagccctccaccgcaagcacctttcgaccaccgcattgtgactccca
aaccccaccagatatcctcctattacaccatcaacagagacgaggtccttggagggggac
gttttgggcaagtccacaagtgcatagagaactcgtctaatctgatgttggctgccaaga
tcattaaagccaggagccagaaagaaaaggacctggtgaggaatgagatccaggtgatga
accagctgaaccaccccaacctcatccagctgtacgccgccttcgagtcgcgccatgaca
tcatcctggtgatggaatatgtggagggaggggaactgtttgaccgcatcatcgatgaga
actacaacctgacagagctggacacagtgctgttcatacgccagatctgtgaaggcctgc
agtacatgcacaagatgtacatcctgcatcttgacctcaagccagaaaacattctttgtg
tcagcagagctactaacaagattaaaatcattgactttggcctggccaggagatataagc
ccagagagaagctgagggtcaactttggaacacctgagtttttagctcctgaagtcatca
actatgagtttgtttcattcccaacagacatgtggagcctgggcgtgattgcgtacatgc
tgctcagtgggctgtctccgtttctgggagacgacgacaacgagacgctgaacaacatcc
tggcctgtcagtggaactttgaggaggaggagttcaaggacatctccgacgaagcaaaag
acttcatcacacttctgctggtgaagagcaagagctggaggatgagcgcagcggagtccc
tcagacacccctggctgtcagacagaagtctgcactatcgactagatcagaagaaaaata
agtgccactccacacacgccccttctccagagaaccagacagaaacactgtga

DBGET integrated database retrieval system