KEGG   Notothenia coriiceps (black rockcod): 104959030Help
Entry
104959030         CDS       T04920                                 

Gene name
pisd
Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00564  Glycerophospholipid metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104959030 (pisd)
Enzymes [BR:ncc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     104959030 (pisd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 104959030
NCBI-ProteinID: XP_010785180
Position
Unknown
AA seq 329 aa AA seqDB search
TPDDVTPLFVLQVALYHSFPTRLLSRAWGRLNGVELPTWLRKPVYSLYIWTFGVNMQEAA
VEDLHHYRNLGEFFRRQLKPAVRPLCASSCLISPADGRILHFGRVQNSQVEQVKGVTYSL
EHFLGPQRGRSQDASRSFQDLLLSSPQNDLFHVVVYLAPGDYHCFHSPTDWRVELRRHFP
GSLMSVNPGVARLVKELFCLNERVALSGQWQHGFFSLTAVGATNVGSIRVYFDQDLQTNA
PRYSKGSFHDRSYVALDDQVLKAAGEGGVASVEGGGVASGEGVVLQRGAAVGEFNLGSTI
VLLFEAPKDFSFDLQPGQRIRVGEGLGSL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
actccagatgatgtcactcccctgtttgtcctgcaggtggcgctgtaccactccttcccg
acccgcctcctctccagagcctggggccgtctgaacggcgtggagctgcccacctggctg
aggaagcccgtctactctctgtacatctggaccttcggggtcaacatgcaggaggcagca
gtggaggatcttcatcactacagaaacctgggagagttcttcagacgacaactcaaacct
gcagtcagacctctctgcgcctcctcctgcctgatttctccggctgacggcaggattctt
cactttggtcgagtgcagaactctcaggttgagcaggtgaagggagtgacctacagcctg
gagcacttcctgggtcctcagagagggcggagccaagacgcgtcccggtccttccaggac
ctgctgctgtcctctcctcagaacgacctgttccacgtggtggtctacctggctccaggt
gactatcactgcttccactcacctacagactggagggtggagctgaggcgccacttccca
ggctctctgatgtccgtgaacccaggcgtggctcggctcgttaaggagctcttctgtctt
aacgagcgcgtggctctgagcggccaatggcagcacggcttcttctcgttaacggcggtg
ggggccaccaatgtgggctccatcagggtctacttcgaccaggatcttcagaccaacgcc
ccccgctacagtaaaggctctttccacgaccgcagctatgttgcccttgacgaccaggtg
ctgaaggcggcaggtgaagggggcgtggcctcggtggagggagggggcgtggcctcgggg
gaaggcgtggtcttgcagcggggggcggcagtgggggagtttaacctcggctctaccatc
gtgctgctgttcgaggcgcccaaagacttcagcttcgacctccagccgggccagagaatc
agggtgggggaggggctcggcagcctctga

DBGET integrated database retrieval system