KEGG   Notothenia coriiceps (black rockcod): 104959308Help
Entry
104959308         CDS       T04920                                 

Definition
(RefSeq) titin-like
Organism
ncc  Notothenia coriiceps (black rockcod)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Ig_2 Pur_ac_phosph_N Tissue_fac ig fn3_2 SusE DUF2369 Invasin_D3 DUF11 ChitinaseA_N
Motif
Other DBs
NCBI-GeneID: 104959308
NCBI-ProteinID: XP_010785478
Position
Unknown
AA seq 2266 aa AA seqDB search
MLVEWNKPGVDGGSMVTGYYLERRDKKSLRWIRVYKEAISDIKKMVYHLTEGNEYQYRVC
SINRAGEGPFSEVSDYYKAADPVETPDEPCKLKVVDSTKTSITLGWSKPEWDGGSEVISY
MLEKLVEGEEEWAMVTAKGEVKTTEYIIHDLKPDVNYFFRVSAVNCAGRGESLEMTEAVQ
AKDILEEAQIDPDVAMRTHYIVKAGKDVELSVPLKGRPAPTASWSKGEECIDSNPKYEFH
HSDNTTVLVMREVTRLDTGKYTVKIENGVGEPKTLTLSVKVQDTPAQCRNLVLKDVTRGK
LTLCWEPPLLDGGAEITNYIVEKKDSSKRIYSAVTSKCTETTYSLEDLSEKASYFFRVMA
ENENGVGDPCDTLDPVKATETPGPVKEVSMKDSSKTSVTLQWLKPDYDGGSIISEYVIEQ
KLKGEEWSRGGTSRQCELEVKKLKEHSTVFFRVAARNDKGQGDFVEMGPIQVIDYIITPE
ACLAEYPGSRISVRLGHNVHIELPYKGKPKPAILWLKDNLPLKESDQIRFKKTENKATLN
IKNVTKGNEGKYTLTLDNRVNRRSFHINVITLGPPSKPIGPIRLDEVRAESITISWDEPN
DDGGGDIACYTVEKRDTSQSDWKMACSSVEDTQYQIANLIKGIQYQFRVRAENRYGSSEP
LVSQSVIAKHQFRPPGPPGKPVVYNVTNDGMTIQWEQPIYDGGCPIHGFNVEKREKNSIM
WQKVNTVLVKETDYRILELIEGLEYSFRVYAQNDAGCSRMSDHSKLNMAVSPVDPPGQPD
YTDVTSDSVTLKWDAPKRDGGSKITSYSLEKRQGKGRWFKANLTDVHECEYTVTGLALNE
RYEFRVTARNAIGVVSPPSNSSGLIVVRNENASPLIEFGPEYFEGLTVKAGDKIRLKATI
TGRPTPKVVWFRDGVLVTKQMMDIINVAGSSTLFVRDADRTHRGLYTVEATNGSGNRKQD
ILVQVQDTPGEPLGPITFSNISEGKCTLSWSEPENDGCSEITHYLIEKRETAKISWALVS
DECTECTFDASKLIKTNEYQFRVSAVNKFGMGRPLESTPVIAQMQYTAPEAPGTPDATEM
TGESITLSWMAPTSDGGNPIQSYIVEKREKKTVKFYKVITKKPIVECAHKVPNLTEDMEY
EFRVMAVNDAGVGAPSNVSLPIKAAEPKDIPCAPSVVCVSDSTNTSISLEWSRPADDGGI
EIMGYIIEMAKGEEEEWTRVNEELVAETNYTVTSLQTGGEYRFRVAAVNHIGRGEEREIP
EPAHAVDRQTPPMVDIDASFRQTHIVKPGASVNLGVNFRGKPVPTATWVKEEEELGVKSE
VTSSDGFSSLSIENCSRNDTGKYTVTLENTSGSKAVTFTVKVMDTPGPPQAVAFKEISRG
TVTLVWEPPLNDGGARIHHYVVERREASRRTWTQSGGNCKQHILRIQDLLEGVPYFFRVS
AENQHGMGEAFEITNPIIATAEPASPKRMDILDTTDSTVVLGWLKPEHDGGSRIQGYILE
AKVKDGDKWMVVGNTTNLTYTVEKLNKGDEYNFRVKAKNESGCSTPRETLVAALVKEPHI
EPAADLSEIPNQLITCNSGKTFTIDVPISGRPVPKVTWKLEEMRLRNSDRVSIQTTKDRT
TISTKEAMRGDSGKYFLTLENVTGTRTFSIEVNVMGRPNPPTGTVEITSITSESCVVNWE
APEDDGGTPITNYIVEKRESGSTAWQLINSSVKRTTLDVGHLTKYMQYSFRVSAENQFGV
SKHIESETIVAEHPFTPSGPPTQPSVCNVTANTMTLKWEEPYHDGGSKVTGYWIEKKERN
NILWVRENKIPCFECYSKMEGLVEGLEYQFRVYAMNSGGLSKASEASKGAVAQNPVDAPS
KPEVTNVTRSTVSLKWSSPLNDGGSPIVGYIIERKPYTLTGEGRWLKCNYTNVIDTVYTV
TALGEGEPYEFRVIAKNANQVFSLPSQSTGSVQCKTDFEPPKAQLDSKLLTEMVRVRAGS
DLVLDAAVGGRPDPKASWAKGTRELELCEKYHLQYTPTRAMAIIKFCDRDDTGKYFLTVR
NVSGTKTAEVNVKVLDTPGVCEGSLEVSRITEESCSLTWKPPLEDGGDDVSHFLVERRDT
NRLNWVVMQAECKEATYDITRLFKNTEYLFRVRGVNKYGTGVPLQSEAMVARNTFTVPSP
PGTPEILVSAEDFATIEWLKPESDGGSPLLHYLVERRERKSARWVKVNRDGAHLDSTLKV
CGLTEGNVYQFRVTAINKAGESEPSEVSLYVVCREPTYLDSDVHSL
NT seq 6801 nt NT seq  +upstreamnt  +downstreamnt
atgttggtggagtggaacaaaccgggggtggatggtggcagcatggtgacaggatactac
ctggagaggcgtgacaagaagagcctgcgctggatccgggtttacaaagaggcaatctca
gacatcaagaagatggtgtaccacctgacagaaggaaacgagtaccagtaccgagtgtgt
tccatcaacagggccggagagggaccgttctctgaagtttccgactactacaaggctgcg
gaccctgttgaaactccggatgagccttgcaagctgaaggttgttgactccaccaagacc
tccatcaccttgggctggtccaagcctgaatgggacggcggcagcgaggtgatcagctac
atgctggagaagcttgttgagggagaagaagagtgggccatggtcaccgccaagggagaa
gtcaagaccactgagtacatcatccacgacttgaaaccagacgtcaactacttcttcagg
gtctcagctgtgaactgtgccggccgtggagaatctctagagatgaccgaggctgtgcaa
gctaaagacatcctggaggaggcccaaattgaccctgacgtggccatgagaactcactac
atcgtgaaggccggtaaggatgtggagctgtctgttcctctgaagggccgaccagctccc
accgcttcctggagcaaaggagaggaatgcatcgacagtaaccccaaatacgagttccac
cactctgacaacaccaccgtgctggttatgcgtgaggtgactaggcttgacactggaaaa
tacacagtgaagatagagaacggtgttggagagccaaaaacgctgaccctgtccgtgaag
gtccaggacaccccggctcagtgcaggaacctggtcctgaaagacgtgactcgtggaaag
ctcactctctgctgggagcctccactcctcgacggtggtgctgagatcacaaactacatc
gtagagaagaaggactcctccaagaggatctactctgcagtgaccagcaaatgcacagaa
acaacatactccctggaagacctctctgagaaggcctcctacttcttccgtgtgatggcg
gagaatgagaatggcgttggcgatccctgcgacaccctggaccctgtgaaggccacagag
actcctggcccggtcaaggaggtttctatgaaggattcttccaagacctcggtcaccctg
cagtggctgaagccagattacgatggtggcagcatcatctccgaatacgtcattgagcag
aagctgaagggcgaagaatggtctcggggaggaaccagccgacagtgcgagcttgaggtg
aagaaactgaaggagcactccacagtgttcttcagagtggcggccaggaatgataaggga
cagggagactttgttgagatgggtcctatccaggtcatcgactacattatcacgcctgag
gcctgccttgctgagtaccctggaagccgcatcagtgtccgtctgggtcacaacgtccat
atcgaactgccctacaaaggtaaacccaaacctgccatcctctggctgaaggacaacctg
cctctaaaggagagcgaccagatccgcttcaagaagacggagaacaaagccacgctgaat
attaagaatgtgacgaaggggaatgaaggtaaatacaccctgaccctggacaacagggtc
aacaggagatccttccacatcaacgtcatcacgctcggaccgccatctaagccaatcggt
cccatccgcctggatgaagtgagagctgagagcatcacgatctcctgggatgaaccaaat
gacgatggcggcggagacattgcttgctacaccgttgagaagagggacacctcccagtct
gactggaagatggcctgctccagtgtagaggacacccagtaccagatcgctaacctgatc
aagggcattcagtaccagttcagagtgcgtgcagagaacagatacggcagcagtgagcct
ctcgtctcacagagcgtcattgccaagcaccagttcaggcctccaggcccgcccggtaaa
cccgtggtgtacaatgttaccaacgacggcatgaccatccagtgggagcagcccatctac
gacgggggttgccccatccatggcttcaatgtggagaagcgggagaagaacagcatcatg
tggcagaaggtgaacaccgtgctggtcaaagagacagactacaggatcctggagctcatc
gaaggccttgagtactccttccgggtctacgcccagaacgacgccggctgcagccgaatg
agtgaccatagcaagttgaacatggcggtcagccctgtcgatcccccgggccagcccgac
tacaccgatgtgaccagtgactcggtgactctgaaatgggatgcacctaaacgtgacggt
ggcagcaagatcaccagctacagcctggagaaacgccaaggcaagggccgctggttcaag
gccaacctgactgacgtgcacgaatgcgagtatactgtcaccggcctggcactgaacgag
cgctacgagttcagagtgacggccaggaacgccattggcgtggtcagccctccctccaac
tcctcaggcttgatcgtggtcagaaacgagaatgcttctccgttgattgagtttggtccg
gagtactttgagggtttgacagtgaaggcaggagacaagatccggctgaaagccaccatc
accggacgccctacccctaaagtggtctggttcagagacggtgtgttagttaccaaacag
atgatggacatcatcaacgtggctggatccagcacgctgtttgtccgggacgctgatcgt
acacaccgcggtctctacactgtggaggctaccaatggatctggaaacagaaagcaggac
atccttgttcaagtccaagacacccccggggagccgctgggacccataaccttcagcaac
atctcggaaggaaagtgtacgctgtcctggagcgagccggagaatgacggctgctcagag
atcacacactacctcattgagaagcgtgagactgccaagatctcctgggcattggtctct
gacgagtgtacagagtgcaccttcgatgctagcaagctcatcaagaccaacgagtaccag
ttcagggtctctgctgtgaacaagttcggtatgggcagacctctggagtccactcccgtc
attgcacagatgcaatacactgctcctgaagctcctggcactcctgatgctacggagatg
accggtgagagcatcacgctgtcctggatggctcctacctctgatggaggtaaccccatt
cagtcctacatcgtggagaaacgagagaagaagactgtcaagttctacaaggtgatcacc
aagaagcccattgtagagtgtgcccacaaggtgcccaacctgacggaggatatggagtac
gagttccgcgtcatggccgtcaacgatgccggcgtgggagctcccagtaacgtttcctta
ccgatcaaagccgccgagcccaaggacattccctgtgctccgtctgtggtgtgtgtgtcc
gactccaccaacacctccatcagcctagagtggtcccgacctgccgatgatggtggcata
gagatcatgggttacattattgagatggcgaagggagaagaagaggaatggacgagagta
aacgaagagctcgtggcagagacaaactacacagtgacttctctacagaccggcggtgag
tacaggttcagagtggctgctgtaaatcacattggccgtggcgaggagcgggagatcccc
gagccagcacatgccgttgacagacaaacgccaccaatggtggacatcgacgccagcttc
aggcagacacacatcgtcaaacctggagcttcagttaaccttggcgtcaacttcagagga
aagccagtcccgacggcaacctgggtaaaggaagaagaagagctgggagtcaagtcagag
gtcacaagttcagacggcttcagttctctgagcattgagaactgctccaggaacgatact
ggaaagtacaccgtgaccctggagaataccagtggcagcaaggccgtcacctttactgtg
aaggtgatggacacgcccggaccaccgcaggctgtggccttcaaggagatctctagaggc
accgtcaccctcgtctgggagcctcctcttaatgatggcggagcgagaatccatcactat
gttgtggagaggcgcgaggctagccgccgcacatggacacagtctggaggcaactgcaag
cagcacatcctgaggatccaggacctcctggagggagtgccgtatttcttcagggtctca
gcagagaaccagcatggcatgggcgaggcctttgagataaccaatcccatcatcgccacg
gcagagccggcgtccccaaagaggatggacatccttgacactactgacagcaccgtggtg
ctgggctggctgaaaccagagcatgacggcggcagccgcatccagggctacatccttgag
gccaaggtaaaggatggagacaaatggatggtggtgggcaataccaccaatctcacctac
actgtggagaagctcaacaagggagacgagtataacttccgtgtgaaggccaagaacgag
tccggctgcagcacgccgagggaaactctggtggctgctctggtgaaagagccgcacatt
gaacccgctgccgacctcagcgagatccccaaccaactcatcacatgcaactcaggaaag
actttcaccatcgacgtccccatcagtggcagacccgttcctaaggtcacctggaagctg
gaggagatgaggctgaggaactccgacagagtctccatccaaactacaaaggaccggaca
accatttccacgaaggaggccatgaggggagacagtggtaaatacttcctcacccttgag
aacgtaaccggaaccaggaccttctccattgaagtgaatgtcatgggcagacctaatcct
cccaccggaaccgtggagatcacatccatcacctctgagtcctgcgtcgtcaactgggaa
gcgccagaagatgacggaggtacgccgatcaccaactacatcgtggagaagcgtgagtcc
ggctccaccgcctggcagctcatcaactccagcgtcaagcgcaccactctggatgtcggc
cacctcaccaagtacatgcagtacagcttcagggtgtccgcagagaaccagttcggagtc
agtaagcacatcgagtctgagaccatcgtcgccgagcatcccttcaccccctctggcccc
ccaacacagccctcagtgtgcaacgttaccgccaacacgatgacccttaagtgggaggag
ccttaccacgatggtggcagcaaggtgacgggctactggatcgagaagaaggaaaggaac
aacatcctgtgggtgagggagaacaagatcccctgctttgagtgctacagcaagatggag
ggtctggtggagggcctggagtaccagttcagggtctacgccatgaacagcggcggcctc
agcaaggccagcgaggcctccaagggggccgtcgcccagaaccctgtcgatgcacccagt
aaacccgaggtcaccaacgtcaccagatccaccgtgtccctgaagtggtcttcgcctctg
aacgacggcggcagtcccatcgtgggctacatcatcgagcgtaagccgtacacgctgacc
ggcgagggtcgctggctgaagtgtaactacaccaacgtgatcgacacggtgtacaccgtg
acggcgctgggcgagggcgagccctacgagttcagggtcatcgccaagaacgccaaccag
gtgttcagcctgccgtcacagtccaccggatccgtgcagtgcaagaccgactttgagcct
cccaaggcgcagctggacagcaaactgctgacggagatggtgcgggtcagggccggttca
gacctggttctggacgctgccgttggaggccggccggaccccaaggcttcctgggcaaag
ggcaccagggagctggagctgtgcgagaagtaccacctgcagtacacccccacacgggcc
atggccatcatcaagttctgcgaccgcgacgacaccgggaagtacttcctgaccgtcagg
aacgtgagcgggaccaagaccgctgaggtcaacgtcaaagtgctcgacacccctggggtg
tgcgagggcagcctggaggtcagcaggatcacagaagagtcctgttccctcacctggaaa
cctcctctggaggacggcggtgacgacgtgtcccacttcctggtggagcgccgtgacacc
aacagactgaactgggtcgtcatgcaggccgagtgcaaggaggcgacctatgacatcacc
aggctcttcaagaacacagagtacctgttcagggtccgcggggtcaacaagtacggcacc
ggggttcccctgcagtccgaggccatggtggccaggaacaccttcaccgtgccctctcct
ccgggcactccagagatcctggtctcagcagaggacttcgccaccatcgagtggctgaag
ccggagagtgatggcggcagcccgctgcttcattatctggtggagcgccgcgagaggaag
agcgcccgctgggtgaaggtgaaccgcgacggcgctcacctggactccacgctgaaggtg
tgcggcctcaccgaaggaaacgtctaccagttcagagtgaccgccattaacaaggcggga
gagagcgagcccagcgaggtctctctctacgtcgtctgcagggagcccacatatttggac
tctgacgttcactccctataa

DBGET integrated database retrieval system