KEGG   Notothenia coriiceps (black rockcod): 104959309Help
Entry
104959309         CDS       T04920                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104959309
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104959309
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ncc04812]
    104959309
   04147 Exosome [BR:ncc04147]
    104959309
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104959309
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104959309
Membrane trafficking [BR:ncc04131]
 Others
  Actin-binding proteins
   Others
    104959309
Cytoskeleton proteins [BR:ncc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     104959309
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104959309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 Pkinase V-set Pur_ac_phosph_N Pkinase_Tyr C2-set_2 DUF1388
Motif
Other DBs
NCBI-GeneID: 104959309
NCBI-ProteinID: XP_010785479
Position
Unknown
AA seq 3279 aa AA seqDB search
MGYILEMQEAGAEEWKKAHEKTLRSAELTVTGLSAGKKYCFRVAGINVNGTGDFSEPCAE
TEPVERLETPDFELHDDLKKTICLRAGGSLRLFVSITGRPVPAITWSKPGVDLQNRGFID
IGSTSTTLIIDRVHRYDAGKYTLVAENSAGKQEVNILVKVYDTPGPTGPIKIKELTKESA
TISWEAPAVDGGAPVNNFIIERREASMRAYKTVTSKCSKTSFKIDGLMEGMLYYFRVLPE
NIYGIGEPCETPDIVLVCEVPLPPQKLEMIDVTKSTVTLGWEKPEHDGGSRLTGYVIEAC
KFGTDKWMKVATLKTTDFEHTIEKLNEKEQYLFRIKAINSRGASEAKEMLTAITVQEQRV
LPVVDFSSIPQKVVNVLSGKTLELDLPLVGRPPPVCSWFFKDNKMKKTERVTIQSTGKFS
KLTMSDTTIDDSGDYTLEVKNVVGVISEVVKVVVLSKPDEPQGPIRFDEVDATTVSCSWD
SPLRDGGAPVSGYAVEQRDAHRPGWVPVCDSVSRPTFKFENLNEGDEYVFRAAAINRFGT
GEFLQSEIVTCRSLKNVPGTPGRPTIFDVSRDGMTVAWNPPEEDGGLEVSGYIIERKEVR
SERWVRANKNPVTMTRYRSTDLIEGLEYEHRITAINARGQSKPSPLSKPAVATDPIDPPG
CPQNPRITDTTKSSVSLAWSPPDDEGDARVDGYLIEMQKAGSMAWMKCNTTPSLICEYTL
TQMPQGEEFKFRVMACNAGGSGEPAEVPGTVIVTEMLESPDYDLELKYKDLYVVRHGGVV
RLSVPVKGKPHPTCTWSKDSGAFSAKAMIASTEDASELVIKGAERSDTGVYELLLQNAMG
KKKATIKVKVIGRPAAPQGPLMFEEIQANSVKVSWKTPEDDGGAEILGYIMERREATRNA
WYTVDSRVTETHLLVKGLSEGVEYHFKVTAENSFGISSSLKSEQPLVPKTPICVPEALIT
APEIMDVTKSSVALAWVKPKYDGGSAITGYFIEHKLVSVETWTRHMVAVSSTMFTLSGLT
PDAEYSFRIVAANAIGQSEAGPTSEPVTCKDPFDKPSQPGEIDTVTVAKNSIAIRWKAPA
CDGGKEVLGYWVEHRKSIESKWTKSSKQMLKEKEKEFTAYGLAEATEYEFRVFAENETGM
SRPRRTATCIRTKLGVETAPGLRKEMDEVTTKLGQPGVMKCQIIGRPLPDIKWYHTGKEV
IESRKFEMSSDGRNHSLSISTDQQEDEGDYTCKAVNDAGEAETTGTLVLEAAARFHPDYP
LKETYYAGLGSTLRIHCVYIGRPEPKIMWLHGAKTLEDTDDISIETTGFYTHLVIKNVQR
RKHGGKYRIRLHNHFGRADTAFNVEIYDKPEMPQGPIKLEALLKNSVIISWKAPADDGGC
MITNYIVEKREDKEGTEWELVSSSINGISCRVPNLIDSAGYFFRVYAQNRYGNSEPLELS
APILIKSQLEKPSPPLSPVVSGITKDSCVVSWKPPLSDGGSKIKCYCLEKKFKKDKKEWS
EWAAVTKDEIKQTVFSAKRLVEGVECIFRVKCENLGGESDYSEETAPIVPVTAVDIRAPA
FKEELRNMSVKYKSNATLVCKILGQPKPVIKWFRRGKEIHSDGKKIKIQEFKGGYHQLVI
TEADDEDSTVYQIRATNQGGSICATVSLDVEIPAKINLPKNLKDKEAIPALRGEVVNIKI
PFSGKPDPVITWQKGQDLIDSNGHYQVIVTRSFTSLVFSNGVEKKDAGFYIVCAKNRFGI
DQQTVELDVADVPDPPRGVKATDVSRDSVRLNWVAPANDGGSKVVSYIIEKCPTTAERWE
RVVQSRDTHYTVTDLFGGTSYQFRVIAENKFGQSTPSETSGPIMTKEDKSRVLLYDQEVD
DSGRVPRGKIHSDVKNMHTKYAIAEELGRGQFGIVHRCVNITTEKTYMAKYYKVRGADQA
IVKKEIATLNLAKHENFLLLQESFDSPEELVLIYDFISGADIFERLSTAEFEFNEREIVN
YIRQICSALDFLHDESYGHFDIRPENIVYTTRTGSNVKIIELGQSRHMTPGDIIKVQYTT
AEYAAPEIHQCDMVSTVTDMWAVGVLTYVLLSGLNPFTAETNQQMIDNISSAAYTYEDES
FKQVSVEALDFTDRLMTKERKHRMSAAEALVHPWLTKPAEEISSRAMQTGRHKRYYQTME
KKEWKTVVSAARIASGGSIRTQRGVFVSKVKIAPFEHGPVGGQISHAVAKEGSNVKFGCN
IENYDSTTEVTWYCGVRQLEAGDKYEIEFEDGLAFITINKVTRADDGTYRCKIVNEYGED
SAYAELFINGVRSYRDFFTARVVKKTKRRVDTARMLQKPPEFTLPLVNRTAYIGEDIRLS
VTVTVHPEPRVVWHKSGQKLVPGQDEKKYTFISDKGLYQMIIHKLEDEDEAEYSVVARNS
FGDDSCKARITVVPRPKPADLTLRPMFKRLLANVECREGQNVRFEIRVSGHPQLKWEKDG
MPLAFGPSIEVIHEGLDYYILHVGGTLIDDSGVYRVTATNSAGSASCQATLKVERSTHVR
REVEMSAKEKKAMAGKAEMDKKVRLSQIMSDTVFIPLPPLAVQAVREAASMFKPAVTTKK
GEKTEAEIQKEKEEKKKRADEKRLRMPYDVPAPRVINPASLVEDVEIKHFQPLSDMKWYK
KLRDQYEFPEPMDKIHQKRLKRIRLSRWDQFYEIPIRIKDHYKPKWRISAMTQDDLETVR
PARQRSPSPELEAYHRIRRRSLGDMSDEELLLPVKEYLSMKRTEEERLRLEDELEYGYSA
SPPSFSPVRFELSALRPSSPRKAYSEDDEAEEARRYDSYRIPSKYEAGPSYVDLRQRHDK
ATHRPQRQKQRVHEEREDQELLRPHTTSQRLSTYKSALKRMEFEEKTRTSKKETTVTVST
FSKDVESEHLTSFTSEYMPKPIKKLETPEPHIRTSRSQERSAVSDAALTKVDYASRYEER
KMALRSERKSVERTFETVTQAPFSLDHGPRITIRMRSHRVPYGSNTRFTLNIQARPEPEV
KWFHNGKEIDQTGKYHMSHLSGVLTLRINNCMTEDSGTYRVVCTNAKGETSDYATLDVAG
EEYAAFSSLRKDEEPPSSHLPEMTRTEEYHMSSSKTTVMESRTETKSTTVVVEKRTEKTT
SPAKILSKPQSLTVEEGDFARFECDADGEPAPSITWLHQGSSIGSSFRHHIISTQRSSSF
EISTVEMSDDGSYSVLVENAGGKQEAHFTLTVRKSESKEKLAARITSPEAKSPIPVKSPE
PIKSPQRVKSPEPIKSPLRVKSPEPIKSPLRVKSPEPLK
NT seq 9840 nt NT seq  +upstreamnt  +downstreamnt
atgggctacatcctggagatgcaggaggccggggctgaggagtggaagaaggcccacgag
aagacgctgagatccgccgagctgacggtaaccgggctctccgccgggaagaagtactgc
ttcagggtcgccggcatcaacgtcaacggcaccggagacttcagcgagccgtgtgccgag
accgagcccgtggagagactagaaactccagactttgagctccatgacgacctgaagaag
accatctgtctgcgtgccggcggatcactccgcttgttcgtcagcatcacaggtcgcccg
gtgcccgccatcacctggagcaaaccaggggtggacctgcagaaccgaggcttcatcgac
atcggcagcacctccaccacgctcatcatcgatcgggtgcaccgctacgacgccgggaag
tacacactggtggcagaaaactctgccggcaaacaggaagtcaacatcctggtcaaagtc
tacgatactcctggacccaccgggcccatcaagatcaaggagctgaccaaagagtcggcc
accatctcctgggaggctccggcggtggacggcggcgctcccgttaacaacttcatcatc
gagcgtcgcgaggcgtccatgagagcctacaagaccgtcacctccaagtgcagcaagacg
tccttcaagatcgacgggctgatggagggcatgctgtactacttcagggtccttccagag
aacatctacggcatcggagagccctgcgagacccccgacatcgtgctggtctgcgaggtt
cctcttccgccgcaaaaactggagatgatagacgtcaccaagagcaccgtgacgctgggc
tgggagaagccagagcacgacggcggcagcaggctgacgggatacgtcatcgaggcctgc
aagttcggcaccgacaagtggatgaaggtggccacgctgaagaccacggacttcgagcac
accatcgagaagctgaacgagaaagagcagtacctgttcaggatcaaagccatcaacagc
cgaggagccagcgaggccaaagagatgctgacggccatcaccgtgcaggaacagagagtg
ctgccggtggtggacttctccagtattcctcagaaggtggtgaacgtcctgtccggaaag
accctggagctggacctgcctctggtgggccggcctcctcccgtctgctcctggttcttc
aaagataacaagatgaagaaaacggagcgcgtcaccatccagagcaccggcaagttctcc
aaactcaccatgagcgacaccaccatcgacgacagcggcgactacacgctggaggtgaag
aacgtcgtgggcgtcatcagcgaggtcgtgaaggtcgtcgtgctctctaagcccgatgag
ccccagggcccaatcaggttcgacgaagtggacgcaaccacagtctcctgcagctgggac
tcccccctcagggatggcggtgcccccgtcagcggctacgctgtggagcaacgtgacgcc
caccggcccggctgggtgccagtctgcgactccgtcagccgacctacatttaagttcgag
aacctcaacgaaggagacgagtacgtgttccgcgccgccgctatcaaccgcttcggcacc
ggagagttcctgcagtcagagatcgtcacctgcaggagcctgaagaacgtgcctggaacc
ccgggccgccccaccatcttcgacgtttcgcgcgacggcatgacggtggcctggaacccg
cccgaggaagacgggggcctcgaggtttccggatacatcatcgagcgcaaagaggtgcgt
tcggagcgctgggtgcgcgccaacaagaacccggtgaccatgacccggtaccggtccacg
gatctgatcgagggcctggagtacgaacacaggataaccgcaatcaatgcccgcggacag
agcaaacccagcccgctgtccaaacccgccgtcgctacagaccccatcgatcctcctggc
tgtccccagaacccgaggatcaccgacaccaccaagtcctccgtgtctctggcctggagt
cctcccgacgacgagggcgacgcccgggtggacggctacctgatcgagatgcagaaggcg
ggcagcatggcctggatgaagtgcaacaccacgccatccctcatctgcgagtacacactc
acccagatgcctcagggcgaggagttcaagttccgcgtgatggcctgcaacgccggtggc
tccggagaacccgccgaggtgccgggaaccgtcattgtgacggaaatgctcgaatctccg
gactacgacctggagctgaagtacaaagacttgtacgtggttcgtcacggaggcgtggtc
cgcctctccgtgcccgtcaagggtaagcctcacccgacctgcacctggtccaaggacagc
ggcgccttctctgccaaggccatgatcgcctccacagaggacgccagcgagctggtgatc
aagggagcggagaggagcgacaccggcgtctacgagctgctgctgcagaacgccatgggc
aagaagaaggccaccatcaaggtgaaggtcatcggacggccggccgcaccccagggcccg
ctgatgttcgaagagatacaagccaactctgtcaaggtgtcctggaagacgcccgaagac
gatggtggtgcagagatcctgggctacatcatggagagacgtgaggcgacgaggaacgca
tggtacaccgtggactccagagtcacagaaacacatcttctggtgaagggcctgtcggag
ggggtggagtaccacttcaaggtgaccgccgaaaactccttcggcatcagctcctctctg
aagtccgagcagcctctggttcccaagacccccatctgtgtccccgaggctctcatcacc
gcgccggagatcatggacgtcaccaagagctctgtggcgttggcctgggtcaaaccaaag
tacgacggtggctctgccatcacgggatacttcattgagcacaaactggtgtccgtggag
acgtggacgcggcacatggtcgccgtcagctccaccatgttcacactgtccgggctcacg
cccgatgccgaatactccttccgcatcgtcgccgccaacgcaatcggacagagcgaggcc
gggcccacgtccgagcccgtcacatgcaaggatccattcgacaagcctagtcaaccgggc
gagatcgacacggttaccgtggcaaagaactctatcgccatccgctggaaggcgccagcg
tgtgacggaggaaaggaggtgctcggctactgggtggaacacaggaagtccatagagagc
aaatggacgaagtccagcaagcagatgctgaaggagaaggagaaggagttcaccgcctat
ggcctcgccgaggcaaccgagtacgagttcagagtgttcgccgagaacgagacgggcatg
agccgaccacgcaggaccgccacctgcatcaggaccaagctcggcgttgaaactgcaccg
ggcctgagaaaggaaatggacgaagtgacaaccaaactgggccagcccggcgttatgaag
tgccagatcatcggcagacccctccccgacatcaagtggtaccacaccggcaaggaggtc
atcgagtcccgcaagttcgagatgagctctgacggccgcaaccactcgctgtccatcagc
acggaccagcaggaggatgagggcgattacacctgcaaggctgtcaacgacgcaggcgag
gccgagaccaccggcacgctggtgctggaggccgctgcacgcttccaccccgactacccg
ctgaaggaaacctactacgccggcctggggtccaccctgcgcatccactgcgtctacatc
ggccggcctgagcccaagatcatgtggctgcacggcgctaagaccctggaggacacagac
gacatcagcatcgagaccaccgggttctacacccacctggtgatcaagaacgtgcagcgc
agaaagcacggaggaaaatacagaatccggctgcacaaccactttggccgggcggacacc
gccttcaacgtggagatctacgacaaacctgagatgcctcagggccccatcaagctggag
gctctgctgaagaactcggtcatcatcagctggaaggcgcccgcagacgatggcggttgc
atgatcacaaactacatcgtggaaaagcgcgaggacaaggaaggcaccgaatgggaactg
gtgtcctcctccattaacggcatctcctgccgcgtgcccaacctcatcgacagcgccggg
tacttcttcagggtttacgcccagaaccgctacggcaacagcgaacctctggagctcagc
gcccccatcctcatcaagagccagctggagaaaccatcacctcctctgtccccggttgtt
tccggcatcaccaaagactcctgcgtggtttcctggaagcctcctctcagcgacggcggc
tccaagattaagtgctactgcctggagaagaagttcaagaaggacaagaaggaatggagc
gagtgggccgcggtgacaaaggatgagatcaagcagactgtgttctccgccaagcgcctg
gtcgagggcgtcgagtgcatcttccgcgtgaaatgcgagaacctgggaggtgagagcgac
tacagcgaggagacggcgcccatcgtgccggtcaccgctgtggatatccgtgctcctgcc
ttcaaggaggagctgaggaacatgagcgtcaagtacaagagcaacgccaccttggtgtgc
aagatccttggccagcccaagcctgtgatcaagtggttcagacgaggaaaggagatccac
tctgacggaaagaagatcaagatccaggagttcaagggaggctaccaccagctggtgatc
accgaggcggacgatgaagactccaccgtgtaccagatcagggccaccaaccagggaggc
tccatctgcgccactgtgtctctggatgtggagattcctgctaagatcaacctgccgaag
aacctgaaggacaaggaagccattcccgccctgcgcggagaagtggtcaatatcaagatt
cctttcagcggcaaaccagatcctgtcatcacatggcagaagggacaagatctcatcgac
agcaacggccactaccaggtcatcgtcaccaggtcgttcacctcgctggtgttctccaac
ggagtggagaagaaggatgccggtttctacattgtctgtgccaagaacaggtttggaatc
gaccagcagaccgtcgagttggatgtggccgacgttcccgatcctccacgtggagtcaaa
gccactgacgtctccagggattctgtcaggctgaactgggtggcccccgccaatgacgga
ggcagcaaggtcgtcagctacatcattgagaagtgccccaccaccgccgagaggtgggag
cgcgtcgtccagtccagagacacccactacaccgtgaccgatctcttcggaggaaccagc
taccagttcagagtcatcgctgagaacaagtttggacagagcaccccatctgagaccagc
ggaccaatcatgaccaaggaggacaaatccagagtcctgctgtacgaccaggaggtggac
gatagtggtcgcgtccccaggggcaagattcactctgacgtcaagaatatgcataccaag
tacgccattgcagaggagttgggcagaggtcagtttggtattgtccaccgctgtgtgaac
atcaccactgagaagacttacatggctaaatactacaaggtgagaggcgctgatcaagcg
atcgtcaagaaggaaatcgctaccctaaatctggccaaacatgaaaacttcctgctcctg
caagagtcctttgacagcccagaggagctggtgttgatctatgacttcatatctggcgca
gacatctttgagcgcctcagcacagccgagtttgagttcaatgagcgcgagatcgtcaac
tacatccggcagatctgctcggctcttgatttcctgcatgatgagagctacggacacttt
gacatcagacctgagaacattgtgtacacaactcgaaccggctctaatgtgaagatcatt
gagttgggccagtccagacacatgactcctggagacatcatcaaagtccagtacaccact
gcagagtacgctgctcctgagatccaccagtgtgacatggtcagcaccgtcaccgacatg
tgggcggtgggtgtcctcacctacgtgctcctcagtggcctgaatccattcacagctgaa
acaaaccagcagatgattgacaacatctccagtgccgcctacacctacgaagacgagtcc
ttcaagcaggtcagtgtggaggcgttggacttcacagaccgcctgatgacgaaggagcgt
aaacatcgtatgtccgcggccgaggctctggtgcatccttggctgaccaagcctgcagag
gagatcagcagcagggcgatgcagaccggcagacacaagagatactaccagacaatggaa
aagaaagagtggaagacagttgtctccgcagcccgtatagccagcggcggctccatcaga
acccagcgtggcgtctttgtctccaaggtgaagatcgctccgtttgaacacggccctgtc
ggaggccagatcagccatgccgtggcgaaagagggaagcaatgtgaaatttggctgcaac
attgaaaactacgacagcactactgaagtcacatggtactgtggcgtcaggcagcttgaa
gctggagacaaatatgaaattgaatttgaggacggcctggctttcatcaccatcaacaag
gtcacaagggcagatgatggcacctacagatgcaagattgtgaacgagtatggggaggac
agcgcctacgcagagctgtttatcaatggtgtcagatcttaccgcgacttcttcaccgcc
cgcgtggtaaagaagacgaagcgcagagtggacactgccaggatgcttcagaagcctccg
gagttcactcttcctttggtcaaccgcaccgcctacattggtgaggacatacgccttagt
gtcaccgtcacagttcacccagagcctcgtgtcgtctggcacaaatctggacagaaactg
gtccctggacaagatgaaaagaaatacacctttatcagcgacaagggcctgtaccagatg
atcatccacaaacttgaggatgaggacgaagccgagtacagcgttgtggcacgcaacagt
tttggtgatgacagctgcaaggctcgtatcaccgttgttccccggcctaaaccagcagac
ctcaccttgaggccaatgttcaaacgcctgctcgccaacgtggagtgccgggagggccag
aatgtgcgctttgagatcagagtatccggacatccccaattgaagtgggagaaggacggc
atgcctttggcctttggaccgtccatcgaggtcatccatgagggtcttgattactacatc
cttcacgtaggaggcactctgattgacgactccggtgtttaccgagtcactgctaccaac
tctgccggctccgccagctgccaagcaacactcaaggtcgagcggtccactcacgtgagg
agggaagtcgaaatgagtgccaaggagaagaaagcaatggctggaaaggcagaaatggac
aaaaaggtgaggctgtctcagattatgtctgacacagtattcatacctctaccacccttg
gcagtgcaggcagtcagggaggcagcctccatgttcaagcccgccgtgaccacaaagaag
ggggagaagaccgaggcggagatccagaaagaaaaagaggagaagaagaagcgcgctgat
gaaaagaggctgcgcatgccatacgatgttcctgctcctcgcgtcattaaccctgcgtct
ctcgtggaggacgtggagatcaaacacttccagccactctctgacatgaagtggtacaag
aagctgcgagatcagtacgagttccctgagccgatggacaaaatccatcagaagaggttg
aagcgtatccgcctctccaggtgggaccagttctacgagattcctatcaggatcaaggac
cattataagcccaagtggcgcatctctgccatgactcaggacgacttggagaccgtgagg
cctgcaaggcagcgctctccttcccctgagctggaagcctaccaccgcatcaggaggagg
tctctgggtgacatgtccgatgaggagctcctgctgcctgtgaaagagtacctgtccatg
aagaggactgaggaggagaggcttcgtctggaggatgagttggagtacggttactctgct
tccccacccagtttcagcccggtgcgcttcgagctttcggccctgcgtccatcatcccca
agaaaagcctacagcgaggacgacgaggcggaagaggcccgcagatacgactcctataga
atcccatctaaatacgaggccggacccagttacgttgacctccgccagcgacacgacaaa
gccacccacagacctcaaagacagaaacagagggtgcatgaggagagagaagaccaggag
ctgctgcgccctcacacaaccagccagaggttatccacctacaagagtgcgctcaaacgc
atggagtttgaggagaagactcgcacctctaaaaaggaaacaactgtcaccgtctcgacc
ttctctaaggacgtcgaatctgaacacctcacatccttcacctccgaatatatgcccaaa
ccgatcaagaagcttgaaacacctgagccccacataaggacatcacgtagccaagaaagg
tctgccgtgtccgatgcggccctcactaaagtcgactatgcctccaggtatgaggagaga
aagatggctctgagatcggagaggaaatcggtggagaggactttcgagacggtgacacag
gctcccttcagtcttgaccacggcccccggatcaccattaggatgcggtcacaccgcgta
ccctacggctccaacaccaggttcaccctgaacatccaggccagacccgagccagaggtc
aagtggttccacaatgggaaagagattgatcagaccggcaaataccacatgagccacctc
agtggggtcctgactctcaggattaacaactgcatgactgaagactccggcacgtaccgc
gtggtctgcaccaacgccaagggagagacttcggactacgccacgttggatgtggccgga
gaggaatacgctgccttctcctcgctccgcaaagacgaggagcctccatcctcccatctc
ccagagatgacccggacagaggagtatcacatgtcctcctcaaagacaaccgtgatggag
agcaggactgagacaaagagcaccactgttgttgttgagaagcgtacggagaagacgact
tctccagccaagatcctgagcaaacctcagtccctgacagtggaggagggagactttgcc
aggtttgagtgtgatgcggacggcgaaccggcgccttcaatcacctggctgcaccaagga
tcctccatcggatcctctttccgtcaccacatcatctccacgcagcgcagctcctccttc
gagatctccaccgtggagatgtcggacgatggcagctactccgtgttggtggaaaacgcc
ggaggcaaacaagaggcccatttcactctgaccgtccgcaagtccgaatccaaggagaaa
ctggcggccagaatcacctcccctgaggccaagtcccccataccagtcaagtcccccgaa
ccaatcaagtctcctcagagggtcaagtccccagagccaatcaaatcccctctgagggtc
aagtccccggagccaatcaaatcccctctgagggtcaagtccccggagccactgaagtag

DBGET integrated database retrieval system