KEGG   Notothenia coriiceps (black rockcod): 104960464Help
Entry
104960464         CDS       T04920                                 

Definition
(RefSeq) sphingosine kinase 2-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00600  Sphingolipid metabolism
ncc01100  Metabolic pathways
ncc04020  Calcium signaling pathway
ncc04370  VEGF signaling pathway
ncc04371  Apelin signaling pathway
Module
ncc_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104960464
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104960464
   04371 Apelin signaling pathway
    104960464
   04020 Calcium signaling pathway
    104960464
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     104960464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 104960464
NCBI-ProteinID: XP_010786833
Position
Unknown
AA seq 890 aa AA seqDB search
MRSPEPSSPSTAEALLHGQFASWGSGSNSNNNSCPNSPGGPGGLSPIASPTPSPASNYAL
TLTHTHIHIQRLSPRSGKEARLLLPLSELVGCSCPRAPAPPLLVLYWYPPGKRRKGVSRR
RQVRAYLAESRSEAERWSAAVQCLLRDVTVTADTEFSRSLLPRPRRLLLLVNPFSGRGQA
MQWCQTHILPMIREANISYNLIQTERQNHARELIREISLPEWDGIIIISGDGLLHEVING
LMERPDWEQAIKTPVGILPCGSGNALAGSINHHAGYDMCLREPLLLNCCFLLCRGGVRPM
DVISVTTSPPPSVNSRPAAPRRLFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLVRI
ASLRSYKGRLSYLPPSINPVSPDTTPPPPRRPLSRSITEGLDEYCRTPIHRTCSDMGISE
QRSLRRGEVEREKEERQKERERRRERARGGGSGVVRASSLAEDREREREGEMEAEEGRSG
TCSESSESIEKEDCNMGRGERLEGIKDEREDEGRVEPDSSEMEVEERGKDGEGSGGSAEG
ERVGCGVDMGRVADGEPEGCLPYPEGFQDTRKALRKNSAPSSQIAHALFNQPLSQEADAD
SGSSFGVEDVDLNGSYYQKEPFQLDVARERSLTISSSPFRHSPFYKPKTLDQNQNASRPR
PLSLLQHSHSNSLPPKLPSLSLSLSPTPPSSPSCASPHSSSYLVPRPNTPNSTSPSPSLR
TPSSTFNFDIAEPAGPQKNRPLFSLPLNAPRDELLPPLDQPLPTRDWITIEGEFVLVLAL
YQSHLGADLHAAPQARFDDGLIHLTFVRAGISRATLLRLFFAMERGTHHSVSSPYVSHIT
CNAFRLQPLSTRGTLTVDGELVPYGPLQAQVHPALARLIVGDSGVKISRF
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctccagaaccgtcttcaccttccacggcagaagcactgcttcacggccagttt
gctagctggggttcaggcagcaacagcaacaacaacagctgccccaacagccctggtggt
ccgggcggactgtcccccattgcctcccctactccgtctccggcctccaactatgccttg
accctaacccacacccacatacatatccagcggctgtcaccacggtcagggaaggaggcc
cgtctcctgctgcctttatcagagctggtggggtgcagctgcccccgggcccctgcgccg
cccctcctcgtgctgtactggtacccaccaggaaaacggcggaaaggggtttctcgacgc
aggcaggtgagggcctacctggcagaaagcaggtctgaggctgagaggtggtcggctgct
gtgcagtgtttactccgagacgtgaccgtcactgctgacaccgaattttcaagaagtctg
ctacctcgtcccaggcgactactgttattggtcaatcccttcagtgggagaggccaggcc
atgcagtggtgtcagacacacatcctgccaatgatcagagaggccaacatcagctacaac
ctcatacagacagagcgtcagaaccatgccagagagcttatcagagagatatcgctccca
gagtgggatggcatcatcatcatctctggagacggcctgctgcatgaggtaatcaatggg
ctgatggagcgtcctgactgggaacaagcaataaaaacacctgtcggcattctcccctgc
ggctctgggaatgccctggctggctccatcaaccaccacgcagggtatgacatgtgcctt
cgggagcccctccttttgaactgctgctttttgctctgtcgaggcggagtccgacccatg
gacgtgatctccgtgacgacaagccctcctccctctgtcaacagtcgtcctgcagcaccc
aggagactgttctctttcctttctgtggcctggggctttgtgtccgatgtggacattgag
agtgagagatatcgtggcctgggctcggctcgcttcaccctgggcaccctggtgcgcatt
gcgtctcttcgatcctacaagggtcgtctgtcctacctgcctccctctatcaaccccgtc
tcccccgacaccacacctcctcccccaaggagacccctctcccgcagtatcacagaaggc
ctggatgaatactgtcgaacgcccatccatcgcacctgctccgacatgggcatcagcgaa
cagaggagcctgcggaggggcgaggtagagagggagaaggaggagaggcagaaagagagg
gagagaagaagggagagggctaggggagggggatctggcgtggtgagggcaagcagcctg
gcagaggacagagagagagagagagagggggagatggaggcagaagaagggaggtcaggg
acatgttccgagagttcagaatcaattgaaaaggaagactgcaatatgggaaggggggag
aggttggaggggatcaaggacgaaagggaagacgaggggagggtagagccagactccagc
gagatggaggtggaggagaggggaaaggatggggaaggcagtggtggttctgcggagggg
gagagagtgggctgtggggttgacatggggcgagtggcagacggagagccagagggttgt
ctcccttacccagagggttttcaggacaccaggaaggccctgaggaagaactcagcccct
tccagccagatcgcccacgccctgttcaaccagccgctcagccaggaggcggacgcagac
tccggctcgtccttcggggtggaggacgtggacctgaacggatcctactaccagaaagag
cccttccaactggacgttgctcgagagcgttctctcaccatctcctcctcccccttccgt
cactctcccttctacaagcccaagaccctggaccaaaaccagaacgcctcccggccgagg
cccctctctctcctccagcactcccactcaaactctctccccccgaagcttccctccctc
tccctttctctttctcctacacccccatcttccccttcatgtgcctccccccactcttca
tcctacctcgtcccccgtcctaacacaccgaactccacctcgccctccccctcgctacgc
acaccctcctcaacttttaactttgacattgccgagccagcaggacctcagaagaaccgt
cctttattctcactgcctttaaatgcccccagagatgagttgttaccccccctcgaccaa
ccccttcccaccagagactggatcactattgaaggggagtttgtcctggtcctggccctt
tatcagtcccacctcggggctgatcttcatgctgcaccccaggccaggtttgacgatggg
ctgatccacctgacctttgtgcgggcggggatctccagagccactctcctgagactgttc
ttcgccatggaaagaggaacccaccactctgtgagctcgccctatgtgagccacatcacc
tgcaatgccttcaggctgcagcctctgtccacacgagggaccctcactgtggacggagaa
ctggtgccctatgggcctcttcaagcgcaggttcatcccgccttggctcgtctcatcgtt
ggtgactctggagtgaagattagccgattctaa

DBGET integrated database retrieval system