KEGG   Notothenia coriiceps (black rockcod): 104960528Help
Entry
104960528         CDS       T04920                                 

Gene name
pc
Definition
(RefSeq) pyruvate carboxylase, mitochondrial
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00020  Citrate cycle (TCA cycle)
ncc00620  Pyruvate metabolism
ncc01100  Metabolic pathways
ncc01200  Carbon metabolism
ncc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104960528 (pc)
   00620 Pyruvate metabolism
    104960528 (pc)
Enzymes [BR:ncc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     104960528 (pc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ALS2CR8
Motif
Other DBs
NCBI-GeneID: 104960528
NCBI-ProteinID: XP_010786910
Position
Unknown
AA seq 924 aa AA seqDB search
MLRFTVVRGGLGMLAVRRTCVSPRFSHSTPQSNIRPINKVMVANRGEIAIRVFRACTELG
IRTVAVYSEQDTGQMHRQKADEAYLIGKGLAPVAAYLDIPDIIRVAKENNVDAIHPGYGF
LSERADFAQACIDAGVMFIGPSPEVVRQMGDKVEARALAISAGVPVVPGTALPISCLNDA
QVFAEQYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALTAFGNGALFVEKFLE
KPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAFQLDPHLRNRLHSDAVNLAK
MVGYESAGTVEFLVDRQGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLHVCEGRSLPEL
SLKQDKIRVNGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAVISP
HYDSLLVKVIASGKDLQTAASKMSRALAEFRVRGVKTNIPFLQNVFSNHQFLNSTVDTQF
IDENQELFNLKPTQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSIDPVIPPVTLGDPPLG
FRDVLLRDGPEGFAKAVRAHQGLLLMDTTFRDAHQSLLATRVRTHDLKKISPFVSHNFNN
LYSLENWGGATFDVAMRFLSECPWKRLQELRALIPNVPFQMLLRGANAVGYTNYPDNAVF
KFCEVAKENGMDIFRVFDSLNYLPNMLLGMEAAGAAGGVVEAAISYTGDVSDPMRQKYSL
DYYMQLADELVKAGTHILCIKDMAGLLKPQSSKLLIGSLRDRFPDLPIHVHTHDTAGAGV
AAMLACAEAGADVVDVAVDSMAGMTSQPSMGAMVACAKGTKLDTARERAIPSTRVHSESA
CCIRSHQDYAVRIVSTPTAQSGTALADRVVHSNMTRRIQYERARKLTTAATQGLQRMEHH
SDKFSTRQICGQNVERSERHAIIV
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggttcactgtagtacgaggcggcctcgggatgctggctgtgaggaggacctgt
gtgtccccgcgcttctcccactctaccccgcagagcaacatccgaccaatcaacaaagtg
atggtggccaacagaggggaaatcgcaatccgtgtgttcagagcctgcaccgagctcggg
attcgaaccgtggccgtctactcggagcaggacaccggacaaatgcacaggcaaaaggcg
gacgaggcttatctgattggaaaaggccttgcacctgttgcagcatacctggacattcct
gacatcatcagagtggccaaggaaaacaatgtggacgccatccaccccggctacgggttc
ctgtcggagcgggcggacttcgctcaggcctgcatagacgcaggagtgatgttcatcgga
ccgagcccagaggtggtccgccagatgggagacaaggtggaggctcgggccctggccatc
agtgcaggtgtacctgtggtcccggggaccgcgttacccatcagctgcctgaacgacgca
caggtgtttgcagaacaatacggcttccccatcatcttcaaagcagcgtacggaggagga
ggccgcggcatgagggtggtccgtgagtacgaggaacttgaggagaattaccagcgggcc
tactctgaagccctgacggcttttgggaacggagccctgtttgtcgagaagtttctggaa
aagccaaggcatattgaagtacagatcctcggcgataaatatggaaatgtcatccacctc
tacgagagagactgctccattcagcggagacaccaaaaggttgtggaaattgcaccggcg
ttccagctggaccctcacctgagaaaccgtctccactctgacgccgtgaacctcgccaaa
atggtgggctacgagagcgcgggcaccgtggagttcctggtggaccgacaaggcaaacac
tacttcatcgaggtcaactctcgactgcaggttgaacacacggtcactgaagagatcaca
gatgtggacctggtgcacgcccagctgcatgtgtgtgagggccgcagcctgcctgagctg
tccctcaaacaagacaagatcagagtgaacggctgcgccatccagtgcagagtgaccacc
gaggacccgtccagaggcttccagcccgacaccggcaggatcgaggttttccgaagcggc
gaaggcatgggcatccgcctggacagcgcctcggccttccagggggccgtcatctccccc
cactacgactccctcctggtgaaagtcatcgccagcgggaaggacctgcagactgcagcc
tccaagatgagccgagccctggccgagttcagagtgcgaggggtcaagaccaacatcccg
ttcctgcagaatgtgttttccaaccaccagttcctcaactccaccgtggacacccagttc
atcgacgagaaccaggagctgttcaacctcaaacccactcagaaccgggcccagaaactg
ctgcactacctgggtcatgtgatggtgaacggaccaaccacacccattccagtcaaagcc
aagccttcctccatagaccctgtcatccctcctgttaccttgggagaccctccgctgggt
ttccgcgacgtgttgctgcgtgacggtccggagggattcgccaaggctgtccgtgcccac
cagggtctgttgctaatggataccaccttcagggatgcccaccagtcgctcctggcaaca
agggttcggacccacgacctgaagaagatctcgccgtttgtcagccacaacttcaacaac
ctctacagcctggagaactggggaggtgccacatttgacgtggccatgcgtttcctgtca
gagtgcccgtggaagaggctccaggagctcagagctctgatcccaaacgtccccttccag
atgctgctgagaggagccaacgctgtgggctacaccaactaccccgacaacgctgtcttt
aagttctgcgaggtggcgaaagagaacggcatggacattttccgcgtgttcgattccctg
aactacctgcccaacatgctgctgggcatggaggctgctggagcggcggggggggtggtg
gaggccgccatctcctacacgggcgacgtctcggaccccatgaggcagaagtactctctg
gactactacatgcagctggccgatgagctggtgaaagcaggaactcacatcctctgcatc
aaggatatggccggcctcctgaagccgcagtccagcaagcttctgattggctctctgaga
gaccgcttccccgacctgcccatccacgtgcacactcacgacaccgcgggggccggagta
gccgccatgctggcctgtgccgaggctggagctgacgtagtggacgtagctgtggactct
atggccgggatgacctctcagcccagcatgggggccatggtggcctgcgccaaggggacc
aagctcgacaccgccagggagagagctatcccgagcactcgcgtgcacagcgagtccgcg
tgctgcatacggagccaccaggactatgcggttcggattgtatccacacctacagcgcag
agcggtacagcgctcgcggaccgagtagttcactccaacatgaccaggcgaatacaatac
gagcgtgcgcgaaagctcactactgcggctacccaaggattgcagagaatggagcaccac
tccgacaaattctccacgagacagatctgtggacagaatgtggagcgcagcgagcgacac
gccattatcgtctga

DBGET integrated database retrieval system