KEGG   Notothenia coriiceps (black rockcod): 104961816Help
Entry
104961816         CDS       T04920                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1-like
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104961816
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104961816
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: Other
  CAMKK family
   104961816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal EF-hand_7
Motif
Other DBs
NCBI-GeneID: 104961816
NCBI-ProteinID: XP_010788464
Position
Unknown
AA seq 255 aa AA seqDB search
HYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSDAR
KSFSGKALDVWAMGVTLYCFVFGKCPFIDEYILALHNKIRTKLVDFQETPNISEELRTLI
LRMLDKNPDTRITIPEIKLDQWVTQGGTDPLPLEEEHCSVVEVTEEDIQNSVKFVPSLSA
VILVRAMLRKRSFSNPFECPSRREERSMSAPGSLLMDSWPFRPSLKMHPSLRKGSTGDGP
REGELEDLHEDEPSS
NT seq 770 nt NT seq  +upstreamnt  +downstreamnt
tgcactaccagaagattgtccatagagacatcaagccctctaacttgctcctgggggacg
acggccacgtgaagatagcggattttggggtcagcaaccagtttgaaggcaatgatgcct
tactgtccagcactgctggcactcctgcatttatggccccagagaccctttcagacgcgc
gaaagagctttagtggaaaagcactggacgtgtgggcgatgggagttacactttactgtt
tcgtttttggaaagtgcccctttattgatgagtacatattggctttgcacaataagataa
ggaccaagcttgtggatttccaagaaacaccaaatatcagtgaagagctgcggactctga
tcctgcggatgctggataagaacccggacaccaggattaccatccctgagatcaagctgg
accagtgggtgacccaggggggcactgatcccttgccactggaggaggagcactgctccg
tggtggaggtgacggaggaggacatccagaactcagtcaagtttgttcccagcctctctg
ctgtgattttggtgagagccatgctgaggaagcgctccttcagtaaccccttcgagtgtc
caagcaggagagaggagcgctctatgtctgcaccaggcagcctgctaatggactcgtggc
ccttccggccctctttaaaaatgcacccctccctcagaaagggcagcacgggagatggac
ccagagaaggagagctggaggacctgcatgaagacgagccctcctcttga

DBGET integrated database retrieval system