KEGG   Notothenia coriiceps (black rockcod): 104963268Help
Entry
104963268         CDS       T04920                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2-like
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00061  Fatty acid biosynthesis
ncc00071  Fatty acid degradation
ncc01100  Metabolic pathways
ncc01212  Fatty acid metabolism
ncc03320  PPAR signaling pathway
ncc04920  Adipocytokine signaling pathway
Module
ncc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104963268
   00071 Fatty acid degradation
    104963268
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104963268
   03320 PPAR signaling pathway
    104963268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ncc01004]
    104963268
Enzymes [BR:ncc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     104963268
Lipid biosynthesis proteins [BR:ncc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   104963268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 104963268
NCBI-ProteinID: XP_010790138
Position
Unknown
AA seq 679 aa AA seqDB search
MAGKHGCPCCPNTEEPRAVPLSTAKAQTALAPADQLWSTSRDQAVRLRMEGSGPASETPI
TVHQLFMETVENYGDRPALVSKTEGQWVTLTWRQYYEQCRAAAKSFLKLGLERYYGVGIL
GFNSAEWFISDVGCIFAGGLATGIYTTNSPEACQYVAESCEANILVVENQKQLEKILQVK
DQLPHLKAIVQYKGELQQKAPFLYTWAEFMKQGEDVPDEQLDAVIDSLRANECCTLIFTS
GTTGHPKGVMLSHDNLTWTVRTAAPGAGLKYGEEVLVSYLPLSHVAAQLIDMWMCVCFAM
KTYFADPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEKMKAAGAKASPMRSAVAGWAKS
IGLQYNYSVMNGENQVPWGFMLANNLVFKRVREALGLDRCKLCFTGAAPVTKDTLEYFMS
LNMPLLELYGMSESSGPHTISSNSSYCIASCGKVMPGAKTKLENPDQDGSGEICFWGRHV
FMGYLNMPDKTTEALDQDGWLHSGDLGRHNKNDFLFITGRIKELIITAGGENIPPVLIED
SVKSEVAIISNAMLIGDKLKFLSIMITLKCVLDDNGDPTDALTPEALSFCQQHDVTATTV
SGIIANKEPAIYTAIQEGIERVNARATSNAQKIQKFVILEQDFSIGGGELGPTMKLRRPI
VVKMYQEKINELYGVTTEK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaacacggctgcccatgttgtcccaatacagaagagcccagggcagttcct
ctgtcgacggccaaagcacagaccgctctggccccagcagaccagctatggagcaccagc
agagaccaggcggtgcggctgaggatggagggctcgggcccggcctcagaaacccccatt
accgtccatcagctcttcatggagacggtggaaaattacggggatcgtcccgccttggtt
tccaaaacagagggccagtgggtgaccctgacgtggaggcaatactacgagcagtgccgt
gcagcagctaaaagcttcctcaagttggggctcgagcgttactatggtgtggggatcctg
ggattcaactcagctgaatggttcatctcagacgttggctgcatttttgccgggggtctg
gcaactgggatttacaccaccaactcacctgaagcttgtcagtatgttgctgaaagctgt
gaggctaatatcctggttgtggaaaaccagaaacagcttgaaaagattctgcaggttaaa
gatcaactacctcatctgaaagcaattgtccagtataaaggcgagctgcagcagaaagca
cccttcctgtatacatgggcagagttcatgaagcagggagaagacgtgcctgacgagcag
ctggatgctgtgattgacagtcttcgggccaatgagtgctgcaccctcatctttacctcg
ggaacaactggccaccctaaaggagtcatgttgagccatgacaatctgacatggacagtc
cgtacggcagctcccggggccggtcttaagtacggtgaggaggtgttggtcagctacctg
ccgctcagccatgtggcagcccagctaattgacatgtggatgtgtgtttgttttgccatg
aaaacatactttgcagatccagatgctctcaagggctccttagtgaacacactgaaggag
gctcgtcccacttgtttcctgggggttcctcgtgtgtgggagaagatgcaggagaagatg
aaagctgccggtgccaaggcatccccaatgaggagcgcagtagcaggctgggccaagtcc
ataggcctgcagtacaactacagtgtcatgaacggggagaatcaggtgccgtggggcttc
atgctggctaataatctggtatttaagagggtccgtgaagcgctgggtttagaccgctgc
aagctctgcttcacgggcgctgcccccgtcaccaaagacactctggagtacttcatgagc
ctgaacatgccgctgttggagttatacggcatgagtgaaagctccggcccacataccatc
tcttctaacagcagctactgcatcgcaagctgtggaaaggtgatgccaggcgccaagaca
aagctggagaaccctgatcaggacgggagtggagagatatgtttctggggtcgccacgtg
ttcatgggctacctgaacatgccggacaaaacaacagaggccctcgaccaggacggctgg
ctgcactctggagatctgggaagacacaacaagaatgacttcctcttcatcacaggaagg
atcaaggagctgatcatcaccgccggaggagagaacatccctcccgtgctcatcgaggac
tcagtgaagtccgaggtggccatcattagcaacgccatgctgatcggagacaagctgaag
ttcctctccatcatgatcacactcaaatgtgtgttggacgacaacggcgatcccacagac
gcactgacccccgaggccttgagtttctgccagcagcacgacgtcacagcgaccacggtg
tcagggatcatagccaataaggagccagctatctacacagccattcaggagggcatagag
cgcgtcaacgccagagcaacgtccaacgcccagaagatccagaagtttgtcatcctggag
caagacttctccatcggtggaggagaactgggacccaccatgaaactgaggaggcccatt
gttgtgaagatgtaccaggagaaaattaacgaattgtatggagtgaccacggaaaagtag

DBGET integrated database retrieval system