KEGG   Notothenia coriiceps (black rockcod): 104963990Help
Entry
104963990         CDS       T04920                                 

Definition
(RefSeq) histamine N-methyltransferase A-like isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00340  Histidine metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    104963990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncc04147]
    104963990
Enzymes [BR:ncc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     104963990
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104963990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_31 Methyltransf_12 Methyltransf_28 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 104963990
NCBI-ProteinID: XP_010790993
Position
Unknown
AA seq 329 aa AA seqDB search
MKTFDFIDMIQLVGGENSAALKWGPIHSVLLSCTLKESVMAAEAKQTCYEGSCVQSFQFY
LEHSGEHEAIMQCVHNVLPGEFQRIGAGKSSLDVLGVGSGGGEMDSQMLTLLQSTFPAVP
ISADIVEGSSKLTDNFKASVAKIANLQKIPFGWHIMHSEDYEKHVEAKGDVKKFDFIHMI
QMIYYVDNLAGTIKFFQSLLKNNGRLMIIVEAANSGWDTLWKTYKKDLCVDTITEYRSSG
EIIACLKSLGLKYDEHTIPNSFDISECFTPSSKLGQRLLNFMTAKDHFDQSFTPEIRAGM
LDLLRNKCSTEKDGKVLFNSTLKCILVHA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatttgacttcatagacatgattcagcttgtgggaggggaaaactctgcagcc
ttaaagtggggaccaattcactctgttctcctttcctgcacactcaaggaatcagtcatg
gctgcagaagcaaagcagacttgttatgaaggaagctgcgtccaaagctttcagttctac
ctagaacactctggagagcacgaggctatcatgcagtgtgttcacaatgtcctgcctgga
gaatttcaaagaattggagcaggcaaaagcagtctggatgtactaggtgttggaagcggt
ggaggtgagatggactcccagatgctgactctgctgcagtccacattccctgctgtcccg
atctctgctgacattgtggagggcagctccaaacttactgacaacttcaaagcatcggta
gcaaagatcgctaaccttcagaagatcccctttggttggcatatcatgcacagtgaggac
tatgagaagcatgtcgaagctaaaggagacgtgaagaaatttgacttcatacacatgatt
cagatgatctactacgttgataacctcgccggcaccataaagttcttccaaagcctgctg
aagaacaatggcaggcttatgatcatcgttgaagcagctaacagtggctgggacaccctg
tggaagacctacaagaaggatctgtgtgtcgacaccatcacagagtatcgctcttccgga
gagattattgcctgcttgaaaagcctcggtctgaaatacgatgaacacaccattcccaac
tctttcgacatctcagagtgcttcactccgagcagcaagcttggacaacgtctgctgaat
ttcatgacggccaaagatcacttcgaccagtccttcaccccagagatcagagcaggcatg
ttggaccttctcaggaacaagtgcagcactgaaaaagatggcaaagtgttgttcaacagt
actcttaaatgcattcttgttcatgcttga

DBGET integrated database retrieval system