KEGG   Notothenia coriiceps (black rockcod): 104964277
Entry
104964277         CDS       T04920                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    104964277
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     104964277
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776
Other DBs
NCBI-GeneID: 104964277
NCBI-ProteinID: XP_010791320
UniProt: A0A6I9PU73
Position
Unknown
AA seq 332 aa
MDMQFVYDLLGENAWSYVGATFVVLWFVVWLYRDSLEIEELTDKYVFVTGCDSGFGNLLC
KKLDRRGLHVLAGCLTEKGADDLKRATGPYLKTVLLDVASQDSIEEAMEWTKKEVGDKGL
WGIVNNAGRSLPMGPTEWMRVEDFHSTLKVNMNGTIAMTMTFLPLIKKARGRIVNIASVL
GRVAANGGGYCISKFAVESFSDCLRRDINYFGINVCIIEPGFFKTAVTSLDPLERELHRL
WNQLTPEVQASYGDKYLDKYIKVQRFIMKAVCDTDLSKVTGCMEHALTAAYPRTRYSPGW
DAKLLWIPLSYMPSCVVDIGLRLVLPRPSKSV
NT seq 999 nt   +upstreamnt  +downstreamnt
atggacatgcagtttgtctacgaccttttaggggaaaatgcttggtcgtacgtcggtgct
accttcgtggttttgtggtttgtcgtgtggctgtacagagacagcctggagatcgaggaa
cttacggacaagtatgtgtttgtgaccggctgtgactctgggtttggtaacctgctgtgt
aagaagctcgatcgtagaggtctccacgttttggccggctgcctcacagaaaagggagct
gatgacctgaagagggcgacggggccttatttgaagactgtcctgctagatgtggccagt
caggacagcatcgaagaagccatggagtggaccaagaaggaggttggggataagggactt
tggggaattgttaacaatgccggacgctcgttacccatgggtcctacagagtggatgaga
gtggaggatttccacagcacattgaaggtcaacatgaatggaacgattgccatgacgatg
accttcctgcccctcatcaaaaaggctcggggccgcattgtaaacatagcatcggttctg
ggtagggtggctgcaaacggtggtggatactgcatctccaaatttgcagtggagtctttc
tctgactgcctcaggagagatataaactactttggaatcaatgtgtgcatcattgagcca
ggatttttcaagactgcggtgacgagcctggaccccctggagagggagctgcaccgcctg
tggaaccagctcacccctgaagtccaagccagctatggagacaagtaccttgataaatac
atcaaggtccagcgttttatcatgaaggcagtctgcgacaccgacctctccaaggtgacc
ggctgcatggagcacgctctgacggcggcctaccctcgcaccaggtacagcccgggctgg
gacgccaagctgctgtggatccccctctcctacatgcccagctgtgtggtcgacatcggg
ctgaggctggtgctgccccgcccgtcaaagagtgtgtaa

DBGET integrated database retrieval system