KEGG   Notothenia coriiceps (black rockcod): 104964527Help
Entry
104964527         CDS       T04920                                 

Gene name
mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00450  Selenocompound metabolism
ncc00970  Aminoacyl-tRNA biosynthesis
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104964527 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104964527 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncc01007]
    104964527 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ncc03016]
    104964527 (mars2)
Enzymes [BR:ncc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104964527 (mars2)
Amino acid related enzymes [BR:ncc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104964527 (mars2)
Transfer RNA biogenesis [BR:ncc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104964527 (mars2)
 Prokaryotic type
   Other AARSs
    104964527 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 104964527
NCBI-ProteinID: XP_010791640
Position
Unknown
AA seq 597 aa AA seqDB search
MRTPFLLVTRSCKAIHRLQQSAFVSSVSALYRHQTISVLRNSSTVSCKDDRSYYITTPIF
YVNASPHLGHLYSAVIADCLHRYKLLQGFNSKFATGTDEHGLKIQLAAEAAGKDPLTFCT
DVSERFKHLFNSCNISYTDYIRTTEQRHHQAVKHFWSVLWNKGLIYKGSYEGWYSTQDES
FLTALQVGDAVDSSGNEIKVSLESGHKVEWMKEENYMFRLSAFRSQLLDWLKGNPRAIQP
ELFYQVVLKWLQEDLPDLSVSRQRSRLQWGIPVPGDAEQTIYVWLDALVNYLTVAGYPDK
HNQWWNVAHHIVGKDILKFHAVYWPAFLLGAGLPLPQTIYVHSHWTVGGKKMSKSLGNVV
DPLERSKQFTTDGMRYFLLRQGVPDSDSDYTDDKAFKLLNAELADSLGGLLNRCTAPALN
PAQVYTAFFPQSFPSEQGGRAVGEDYHMLEAVKNLPAVVEQHYESMHVFKALEAISACVR
QTNRFVQRHAPWKLERSDIRDQRWLDTIIHVSFECLRMYGTLLQPVVPEISDKLLSRLGV
QPDERGLADVNFLPKIRGMNCPFEGRVLGSDTGVLFTRLENLDIDKQNPKKTKKAKK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccccttttctgcttgtcactagaagctgtaaggctattcacagactgcaacaa
agtgcatttgtctcatcggtttcagctctatacaggcatcagacgatctctgtgttgaga
aattcaagcactgtttcctgcaaagacgacaggagttactacataacgacccccatcttc
tatgtcaatgcctctcctcatttaggacacttgtattcagctgtgatagctgactgctta
cacaggtacaagctactgcagggcttcaactcaaagtttgcaacaggcacagatgaacac
ggcttgaaaatccaactagctgctgaagctgcaggaaaggatcccctgacattttgcacc
gatgtgtctgagagattcaaacatctcttcaacagctgcaacatatcgtatacagactac
ataagaaccactgagcagagacaccatcaggctgtgaaacacttctggtcagtgctctgg
aacaaagggctcatctacaagggcagttatgaaggctggtactccacccaagatgaaagc
ttcctcacggcgttgcaggtcggggacgctgtggactcatcagggaatgagatcaaagta
tcgctggagagtggccacaaggtggagtggatgaaagaggagaactacatgttccgtctg
tctgcgtttcgctctcagctgctcgactggctcaaaggaaatccccgggccatacagcct
gagcttttctaccaggttgtcctcaagtggctgcaggaggaccttcctgacctttcagtg
tcccgccagagaagccgccttcagtggggcatcccggtcccaggtgatgctgaacaaacc
atctatgtgtggctagatgctcttgtgaactacctcactgtggctggctatccagataaa
cacaaccaatggtggaacgtggcccaccacatagttggaaaagacatcttaaaattccat
gccgtctactggccagcttttcttctcggagctggactgccgctgccacaaacaatctac
gtgcactctcactggaccgtaggaggaaagaaaatgtctaaaagtttgggtaatgtggtg
gaccctcttgagcgctcaaaacagttcacaactgatggtatgcggtactttcttctgcgt
cagggtgtcccagactcggacagtgactacacagacgacaaagctttcaagttgctaaac
gcagagctggctgattctctgggcggtcttctgaaccgctgcacagctccagctctaaac
ccagctcaggtctacactgccttcttccctcagtcctttccaagtgaacagggaggcagg
gctgtgggtgaagactaccacatgttggaggctgtgaaaaacctccctgctgtggtggag
cagcactatgagagcatgcatgttttcaaagctctggaggccatcagtgcctgtgtgagg
cagaccaacaggtttgttcagcgccatgcaccttggaagctggagaggagtgacattaga
gaccagcgctggctcgacaccatcatccatgtctccttcgaatgcctgaggatgtatggc
acactcctccagcctgtagtgccggagatttctgacaaactgctctccagactcggggtg
caaccagacgagaggggcttggctgatgtgaacttcctgccaaagattaggggaatgaac
tgtccgtttgaagggagagtgctaggatctgacactggagtgctttttactcgcttggaa
aatctggatatagataaacaaaaccctaagaaaacaaagaaggctaaaaagtga

DBGET integrated database retrieval system