KEGG   Notothenia coriiceps (black rockcod): 104967121Help
Entry
104967121         CDS       T04920                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104967121
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ncc04030]
    104967121
G protein-coupled receptors [BR:ncc04030]
 Rhodopsin family
  Lipid
   Leukotriene
    104967121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 104967121
NCBI-ProteinID: XP_010794834
Position
Unknown
AA seq 385 aa AA seqDB search
MASNITTTISQQSSSFSLPLSINHMVGIAILTLAFVLGFPGNLFVVWTVLCRVKKRSVTC
LLVLNLSMADAFVLLSAPLFLRYLAGGRGWEFGSAACKLVHYLSSVNMYVSIYLICLMSM
DRWLAVSRPFLSQRMRTKRSLLILLLVIWVLAFLMSLPMPFYRSNVKKIFPNNISLSFCM
PYHWKSKGHRVFQYLFETIMACLLPFSLINTCYSSVICRLQSAKFQRRAQGSRLILMIIC
TFAVFWLPYHIVNIIEVVGLLQDSKSTVDAALAARPNVTAFAYFSSAINPILYVFAGSSH
IRNAGLSFMGKLFEATNSESRTTSTFARSGRISRSSSSPDESSVLNTLSVKLGRPFKSKH
KDRSGSVPGKEVDEPELRSLANQLN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatatcaccaccaccatctcccagcagtcttcttctttctcccttcctctg
tccatcaaccacatggtcggcatcgccatcttgaccctcgcctttgttctgggcttccct
gggaacctgtttgttgtttggacagtgttgtgccgggtaaagaagcgctcagtgacctgt
ttgctggtgctgaatctgagcatggcggatgctttcgtgctgctcagcgcccctttgttc
ctgcgctacctggctggaggccgaggctgggagtttggctcggcagcatgcaagctggtg
cattacctatcgagtgtgaacatgtacgtctccatctacctcatctgcctgatgagcatg
gaccgctggttggccgtgtccaggccgtttctgtcccagaggatgagaaccaagcgctcc
ctcctgattctgctgctcgtcatatgggtgttggcgttcctcatgtcactgccgatgcct
ttttaccgcagtaatgtgaagaagattttcccaaacaatatctctttgagcttctgcatg
ccgtaccactggaagagcaagggtcaccgggtcttccagtacctgtttgagaccatcatg
gcctgtctgttgcctttctccctcatcaacacatgttactcctccgtcatctgtcgtctg
cagagtgccaagttccagcgccgagcacaaggcagccgcctcatcctgatgatcatctgt
acctttgcagttttctggctgccgtatcacatcgtcaacatcatagaggtagtgggtctg
ttgcaggacagtaaatccactgttgatgccgcccttgcagcccgtccaaatgtcacagcg
tttgcctacttcagcagtgcgatcaatcctattctgtacgtgttcgccggcagctcccac
atccgcaacgccggcctcagcttcatgggaaagctcttcgaggccaccaactccgagagc
aggaccacgtctaccttcgccagaagtggtcgcattagccgcagcagctcttcaccggac
gagagctccgtcctgaacacgctctcggttaaactcgggaggcctttcaaaagcaagcac
aaggacaggagcggcagcgtgccgggaaaagaggtggatgagcctgaactcaggtctctg
gccaaccaactaaactga

DBGET integrated database retrieval system