KEGG   Notothenia coriiceps (black rockcod): 104967240Help
Entry
104967240         CDS       T04920                                 

Definition
(RefSeq) separin-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04110  Cell cycle
ncc04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104967240
   04114 Oocyte meiosis
    104967240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104967240
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104967240
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     104967240
Peptidases and inhibitors [BR:ncc01002]
 Cysteine peptidases
  Family C50: separase family
   104967240
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    104967240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12
Motif
Other DBs
NCBI-GeneID: 104967240
NCBI-ProteinID: XP_010794958
Position
Unknown
AA seq 1650 aa AA seqDB search
MSFLSAVKESVVSKLSPRAVDMKCLKVEEYIKQTASVKETDVLRQELQKYVKSQPGLQGR
TICDRIIRACNNQLGVGSPISDHVSVLVQLVELSLHGYDVSEALVAQSSPLYMEKIIFHI
VKKLSSLEAHNQCSHVAGLLYGRLSVAQQAEDYFALVRSCFSVLWNGLSATKDIKILNSH
DKLHCQMQALSFLLLLDTDSATPSISKAPIYTEDAITEFESSFETVTKDNAYFLLQKMQT
LFNRCWTGSDGAGSKQLTVASSIYTLSEMALIIVKMLCKFAHYDLASTFLSEIESKLKDL
ADCQCTAVVLGKWAVKIHSTMKAGVESGPALTECARALRSLSADLGDREAHAVLEACGLV
LWAVESDHSNGLSGPVLLAFFSFLEEHQEQIIKVLKKSSTCQAELSRLQQALCINIYQGF
GFAYESMVALQLENIETLDRVLLYCQATAGQMMTELRKLSSESLLIKSVISVSNLACGFY
NRRLYDQAFSLVEILCRELSKNCPTSLCVDRLSRPFMLAVQTSRRAGHLERALDWVILWL
KALGDNITSHMAEPVSLWVKTKTDAARNSEEDIRLRTLHDGFGPDVPDERVMLCLLEEEL
RAYKDVAGDTSQERYNTLCDLLDICHEDSSHTHLRAVYLSEMAQVVCYQDFSEQTDCTAV
DFTHEALRLLEEEPETPENADRLKDDKAHALLWLYICTLEKNLQEGIERDKEKRESREQS
RCSAIPIGTNDLDYEDKQKTQESIPVYEGLHFNLAAENKLCKPLERALDEWSALLQSKVL
PSVRNPKQTCGSLAVTAALFRLMAKPLKALEAYQLAIGLSRELADAPGCATSLCQSASIL
LDMGSPDLALAQLEQAEKFLTSVPSDDGPSYLSMTAVLLKAQYCYSTGQVDQGVAYLCEV
LKEMNTQRQSKSLYLLRARTLQTCSSYLSLDSDALPQAQRNLITQHGTRGLDTALYESLK
LLCSLLVALVGKGLYGTNNNSSSCSDTRFIDQGDNLVLKWQLLSELLSCSMKMVAVRSSC
GAINDARLQCLEALKLATKLQALSQCAELLVIKAELELMLGEKDESGIDLDRVRDLLDLC
TDFSDHVQKAEVKIKPRKGRPVKKSQLPLPALEDDLKGMLSTRWNNREPIVRDLSSSPPL
KVQPRRWLSSLAHEPACPCPCCSEPCLGRATARWAATQADLILQLDPNDAKVSFKLQSAT
LTRCKSVAAKVGAKLAKLFPPHGPSKRSSKPSLMHDVVGRVYLHMALSALEPRHNKVCGI
WKVLEAGLAFVDSTTSHVLGPVRAGLMATKAIVSLVTLAEKKGCTPEEFFSNAWTWNTSK
EDLKSEEKAVPPSSLLKKPKESIIKIPDKTKEAKKVRTVPPRIQGAGSSTKGKRLVHMMP
VRVKPDLGAFGFNTEVPTLFCTPIPKVKAPPTEQKAQRTAPKIQFNVYEELSPEQKKAQP
VPGAPRRTNKPFFKLDFSDESDTESNTQAEPKGKKKTDVPKKRATTRRAAQNSKTTPDPP
PAEKVPAKRQTKGRKTTALPQSFSSEDDETVVSHTATARRGRSRKELSRPDPDSLEKPDK
MRTIEEETTGLLDISMEQLRASDTETEDNLSKDIDFEVLRRDTYCARDPLSELKSRGHLR
EAPLTHLSHSDTRPDVQWIESADILPAHLG
NT seq 4953 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttttatctgctgtaaaggaaagtgttgtttcaaaactctcccctagagctgtc
gacatgaagtgcttgaaagtggaagaatatatcaagcagactgcttctgtgaaagagacg
gatgttttacgtcaagaactacagaagtatgtgaagagtcaacccggcctccagggtcgc
acaatatgtgacaggatcatcagagcctgcaacaatcaactcggagttggatctccaatt
tctgaccatgtcagtgtgttggtccagctggtggagctttctcttcacggctatgatgtt
tctgaagcacttgttgctcagagcagtccgctgtacatggagaagatcattttccatatt
gtcaaaaagctaagctcccttgaagctcacaatcaatgtagccatgtcgctgggttgctt
tacggcaggctttctgtagctcaacaggctgaggactactttgctcttgtgcgaagctgc
ttttcggtgctctggaatggattatctgcaaccaaagacatcaaaatcctaaattcacat
gacaaacttcactgccagatgcaagctctgagcttcctcttgctgttggacacagacagt
gcaaccccatctatctccaaagcccccatatacacagaggacgccatcacggaatttgag
agtagctttgaaacggtaaccaaggacaatgcttattttctccttcagaaaatgcagaca
cttttcaacagatgttggactggcagcgatggcgctgggtccaagcagttgactgtggca
tcaagtatatatacgctctcagaaatggcactgattatagtgaagatgctttgtaagttt
gcccactatgatctggcctccacctttttgagtgaaattgagagcaagctcaaagacttg
gctgactgtcagtgtacagctgtggtgctcggcaagtgggcggtaaagattcattccaca
atgaaggccggcgttgagagtggcccggctctgacggagtgtgcgagggccctgaggtct
ctatcagctgacctgggggacagagaagctcacgcagtcctagaagcatgtggactcgtg
ttatgggctgtcgaaagtgaccacagcaacggattgagcggacctgtgctcctggctttc
ttttcttttcttgaggagcaccaagaacagataataaaggttctaaagaagagttcgaca
tgccaggctgagctcagcagactgcagcaggctctctgcatcaatatctaccaaggcttt
ggatttgcctatgagagcatggtggcattacagctggagaacattgaaaccttggacaga
gtgctgctgtactgccaggccacagctggacagatgatgactgaactacgtaaactgtcc
agtgaaagtcttctcatcaaatcagtgatttctgtgagcaacttagcttgtggattttac
aaccggcgtctctatgaccaggccttctctctggttgaaatcctctgtcgggaactaagc
aagaattgccccacctcgctctgtgtcgataggttgagccgcccgttcatgttggctgtg
cagacgtctcggcgtgccggacatctggagcgggcgctggactgggtcatcctgtggctg
aaggctctgggggacaacatcacttctcacatggctgaacctgtctctctgtgggtgaaa
acaaagactgacgctgcccgtaactctgaggaggacatccgtctcaggacattacatgat
ggatttggacccgacgtccctgatgagagagtaatgctctgcctattggaggaagagctg
cgtgcctataaggatgtggcaggagacacgtctcaggagcgttacaacacactctgtgat
ctgttggacatctgccatgaggacagctcacacacacatctgcgtgctgtctatctctct
gaaatggcccaagttgtgtgttaccaggatttcagtgaacagactgactgcacggcagtg
gatttcacccatgaagctctacggctacttgaagaagaaccagagactccagagaatgca
gacaggctgaaggatgacaaggcccatgctttactctggctctatatctgcactctggag
aaaaatcttcaggagggcattgaaagggacaaagaaaagcgagagtcaagagagcagtca
cgatgttcagccattcccataggaactaatgatttagattatgaagacaagcagaaaaca
caggaaagcattccggtctatgaaggcctgcatttcaacctggctgcagagaacaagctg
tgcaaacctctggaaagagccctggatgagtggtctgctcttctgcagagtaaagtcctg
ccttctgtcagaaaccccaaacagacctgtggctccctcgctgtgactgcggctctcttc
agactcatggcaaagcctctgaaggctctggaagcttaccaacttgcgattggactttca
cgtgaactcgctgacgcccctggatgtgccacctccctctgtcagtcagccagcatcctt
ctggatatgggctcccctgatctggctttggcccaactagagcaagcagagaagtttctt
acctctgtgccctccgatgatggaccttcttatctgtctatgacggcagttctgctgaaa
gctcagtactgctacagcacaggacaggtggatcagggggtagcatatctgtgtgaggtg
ctgaaagaaatgaacacgcagaggcagtcaaagagcttgtacctgctgcgggctcgcacg
ctccagacctgcagctcctatctgagtttggactcagatgcactgccacaagcccagaga
aaccttatcacccagcacggaacaagaggcctggacactgccctgtatgagagcctgaag
cttctgtgcagcctgctggtcgctttagtggggaaggggctatacgggactaacaacaac
agcagcagctgctcagacacacgcttcatcgaccaaggagataacttggtgctgaaatgg
cagctgctctcagagctgctgagttgctctatgaagatggtggctgtgaggagcagctgt
ggagccatcaatgacgccaggctccagtgtctagaagctttgaaactggccaccaagctg
caagcactcagccaatgtgcggagctactggtgatcaaagccgagttggagctgatgctg
ggggagaaagatgaaagtggaattgatttagacagagtcagagatcttctggacctatgt
acagatttctctgatcacgtgcagaaggcagaagtgaaaatcaaacctaggaaaggtcgc
cctgtgaagaagtcacagttgccccttcctgctttggaggatgatctcaaaggcatgctg
agcaccaggtggaataacagagagcctatagtgagggatctgagcagctcaccccctctt
aaagtccagcctcgccgctggctctcctccctggcccatgaaccggcctgcccctgcccc
tgctgctctgagccctgtctgggccgcgccaccgcccgctgggccgccactcaggccgac
ctcatcctccagctcgatcccaacgacgccaaagtcagtttcaaacttcaatcggcaaca
ttaactcgctgcaagagtgttgctgccaaagttggggcaaaattggctaaactctttcct
ccccatggaccttcaaaaagatcctctaaaccctccctgatgcatgacgtggtgggccgc
gtctacctccacatggccctgtctgcactggagccaaggcacaacaaggtttgtgggata
tggaaagtactggaagctggtttggcatttgttgattccacaacttcacatgtgctcgga
cccgtgagagcaggcctaatggcaaccaaagctattgtgtcattggttaccttggctgag
aaaaagggctgcactccagaagagttcttctcaaatgcttggacttggaacacatcaaag
gaagatctgaaatcagaagagaaagcagtgcctccctcatccttgcttaaaaagcccaaa
gagtccattataaaaattcctgacaaaacaaaggaggccaagaaggtgaggactgtcccg
cccaggattcagggggctggctcctccaccaaaggaaagcggctggttcacatgatgcca
gtaagggtgaagcctgaccttggagcttttggctttaacacagaggtacctactttgttc
tgtactcctattccaaaggtaaaagcccctcccacagagcagaaagcacagaggactgct
cctaagatacagttcaatgtgtatgaagagttgtcaccagaacagaaaaaagcccaacct
gttcctggagcccccagacgcacaaataaaccctttttcaagctggattttagcgatgag
agtgacacggaatccaacacccaagccgagcctaagggaaaaaaaaaaacagatgtccct
aaaaagcgagccaccacaagaagagctgcgcagaacagtaaaacgactccagacccccct
cctgcagagaaggtcccagccaagaggcagaccaaggggaggaagaccaccgcactcccc
cagtcgttttcttctgaggatgacgagactgtggtcagtcacactgccacagcaagaaga
ggaagatccagaaaggagctttccaggccagacccagactcactggagaagcccgacaag
atgcggaccatcgaggaggaaaccactggacttctggacatcagcatggagcagctcagg
gcatccgacactgagactgaggacaatcttagcaaagatattgatttcgaagtgctgcgg
agggatacgtattgtgcgagagaccccctgtctgaactgaagagcagaggtcatctgaga
gaagctccactgacccacctctctcattccgacaccaggccagacgtgcaatggattgag
tctgctgacatcctccctgctcatttgggttga

DBGET integrated database retrieval system