KEGG   Notothenia coriiceps (black rockcod): 104968212Help
Entry
104968212         CDS       T04920                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04012  ErbB signaling pathway
ncc04020  Calcium signaling pathway
ncc04114  Oocyte meiosis
ncc04217  Necroptosis
ncc04261  Adrenergic signaling in cardiomyocytes
ncc04310  Wnt signaling pathway
ncc04912  GnRH signaling pathway
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104968212
   04310 Wnt signaling pathway
    104968212
   04020 Calcium signaling pathway
    104968212
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104968212
   04217 Necroptosis
    104968212
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104968212
   04916 Melanogenesis
    104968212
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104968212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104968212
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104968212
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104968212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaMKII_AD Pkinase Pkinase_Tyr SnoaL_3 DUF4440 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 104968212
NCBI-ProteinID: XP_010796091
Position
Unknown
AA seq 519 aa AA seqDB search
MLHYHGAYATALLPPCHDPSRRIANELWGSTRIRSRAGAYALWPENLLLASKMKGAAVKL
ADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFW
DEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAEQALKHPWVCHR
STVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQHTNSAAAASSTASLAQ
EACKSLLNKKSDSAKPSTNNSKNSIVSAINALKDTNMATNAQMESQSTVVHNPPDGVKGS
TESNATNDEEEMKADSSAQSSATEEMPPLLPSPQSSPAIPPHDVKRMAWNSTGNSSCPDS
ELSQSSMPAAPLGSNSVAASSTTKLIRKQEIIKITEQLIEAINNGDFDAYTRICDPGLTS
FEPEALGNLVEGMDFHKFYFENLLSKNSKPVHTTLLNPHVHLIGEEAACIAYIRLTQFVD
TTGRPRSSQSEETRVWHRREGKWLNVHFHCSGAPAAPLQ
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgcactaccatggcgcatatgccaccgcgctgttgccgccctgtcacgacccctct
cgacggatagccaacgaactttggggatctaccaggatacggagccgtgccggtgcgtac
gcgttgtggcctgagaacctgttgttggccagtaagatgaagggagctgcagtgaagctg
gcagactttggccttgctattgaagtgcaaggagaccagcaggcttggtttgggtttgcg
ggcacccctggctatctctcccctgaagtgctgaggaaggacccctacggcaagcctgtg
gacatatgggcttgcggtgttatcctctatatcttgttagtgggatatcctcccttctgg
gatgaagatcaacacaaactctatcagcagattaaagctggagcatacgatttcccttcc
ccagagtgggacacagtgactccagaggcaaagaacctgatcaaccagatgttgaccatt
aaccccgccaagaggatcactgccgaacaggccctgaagcacccatgggtctgccaccgc
tctacagtggcatccatgatgcacagacaggaaactgtcgagtgtctccgcaagttcaac
gctcgccgaaaacttaagggagccattctcaccaccatgctggtgtccagaaacttctca
gtgggccggcagcataccaactctgctgctgccgcctcctccacggcctcactggctcag
gaagcatgcaaaagtttactcaacaagaagtctgattctgctaagccttctaccaacaac
agtaagaacagtatagtgagcgccatcaatgctctgaaagacaccaacatggcaaccaac
gcccagatggaatctcagagcactgtggtgcacaaccctcctgatggagttaagggatca
acagagagcaacgccaccaacgacgaggaggaaatgaaagcggacagttcggcgcagagc
agcgccacagaggagatgcccccacttctgccctcacctcaaagctcccctgccattcca
ccgcatgacgtaaagcgcatggcatggaacagcacgggcaacagctcctgccctgactct
gagctctctcagtcctccatgcctgccgctccactagggagcaactctgtggctgctagc
agcaccacgaagctgatccgtaagcaggagatcatcaagataacggagcagctgattgaa
gccatcaacaatggagatttcgatgcctacacgaggatttgtgatcctggactcacctct
tttgaacccgaggccctggggaacctggtggaggggatggacttccacaagttctacttt
gagaacttgctgagcaagaacagcaagccggtgcacaccaccctgctgaaccctcacgtg
cacctgatcggcgaggaagcggcatgcatcgcctacatccgcctcacacagtttgtggac
accacaggccgccctcggtccagccaatcagaggagaccagggtgtggcatcgccgcgaa
ggcaagtggctgaacgtccacttccactgctcgggagcgcccgccgcaccactacagtga

DBGET integrated database retrieval system