KEGG   Nosema ceranae: NCER_100537Help
Entry
NCER_100537       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
nce  Nosema ceranae
Pathway
nce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    NCER_100537
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nce03041]
    NCER_100537
Enzymes [BR:nce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     NCER_100537
Spliceosome [BR:nce03041]
 Complex C
  Other components
   Step II factors
    NCER_100537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C DEAD AAA_14 ResIII AAA_7 OB_NTP_bind Rad17 Helicase_RecD ABC_tran Viral_helicase1 DUF815 AAA_22 T2SSE Sigma54_activat ERCC3_RAD25_C RsgA_GTPase AAA AAA_29
Motif
Other DBs
NCBI-ProteinID: EEQ82698
UniProt: C4V7U6
AA seq 593 aa AA seqDB search
MSTPLGYNLLIENYSSEIIKCIENSKHVLIKGPTGCGKSTYIPLLLNNNKHKIAVIEPRR
IAVMSLYSTLFKVTKNVGYKMRFNKKIKHDDKIIIFTDGAFLHEGIDSNYDYIILDEVHE
RSIRMDMILCLLKQTKSKVILMSATVDTKRIMNYFDAKLFEIPGESYPCDIIYSESSVSD
YILESYNIIKEIVMSKDVKNLSRNNSIAWLDKSNKNKDCYTINNNRDILVFLTGEEDIND
LFVLLKKILDIKVYKIFSSLNDEEQLKIYQKSTIRKVILSTNICETSLTIPGIKYVIDCG
LVKNKIFDGINYFGIVPISKESADQRLGRCNRIGPGICYRLFTEEMYNNLSNLTPEILIA
NLSKPILQLIHKKIDIFNFSFLDYPTQLNVFRSLEFLYNKKLINENMQITKQGIRILRYP
FELNLSCFYDDCINSGLGYYGSMLVSMISIDNYNFIKNLDMVQGKNIDKEMFTTDIKYLI
NIFSNFLNAKVKKEFCKINEISLKNLDKAYKIFKGLNKNKNGNVDLLEKIFSKSFDYNLS
VREQDGSYKHVASGRKLYIHPTSNFFKKNIKKIVFVDVLCTTKEYVRIVGKYL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaccacttggatataatttgctgatagaaaattattcaagcgaaataataaaa
tgcatagaaaattctaaacatgtgcttattaaaggacctacaggatgtggaaaatctacc
tatattcctttattactaaataataataaacataaaattgctgttatagaaccaagaaga
atagctgttatgtctttatattctacactttttaaagttacaaagaatgttggttataaa
atgcgatttaataaaaaaattaaacacgatgataaaattattattttcactgatggtgct
tttttacacgaaggaatagattctaattatgattacatcattttagatgaagtccacgaa
agatctataagaatggatatgatactttgtttgttaaaacaaacaaaatccaaagtaatt
ttaatgagtgctacagttgatacaaaaagaattatgaattattttgatgcaaaacttttt
gaaattccaggagaatcctatccttgcgatattatatattctgaatcttctgttagtgat
tatattttagaatcatacaatattattaaagaaatagtaatgagtaaggatgtaaaaaac
ttatctaggaataatagcatagcttggctagacaagtcgaataaaaataaagattgttat
acaattaataacaatagagatattttggtttttttaacgggagaagaagatattaacgat
ttgtttgttttactaaaaaaaatactagatattaaagtttataaaattttttcaagttta
aatgatgaagaacaattaaaaatttaccaaaagtctaccattcgaaaagttattttgagt
acaaatatttgcgagacctccttaactattcccggcataaaatacgttatagattgcggt
cttgttaaaaataaaatttttgatggtattaattattttggaatagtgcctatttctaaa
gaatcggcagatcagagactgggtagatgtaatagaatagggcccggtatatgttataga
ttatttaccgaagaaatgtataataatttatctaatttgacaccagagatattaatagca
aatttatctaaacctattcttcagcttatacataaaaaaatagatatttttaacttttct
tttttagattatcctacacaacttaatgtatttagatccttagaatttttatacaacaaa
aagcttattaatgaaaatatgcaaattaccaagcaagggataagaattttaagatatcct
tttgaacttaatttaagttgtttttatgatgactgtataaatagtggactaggatactat
ggttctatgcttgtttcaatgataagtatcgacaattataattttataaaaaatttagat
atggtacaaggtaaaaatatagacaaagagatgtttacaactgatatcaaatatttaatt
aatattttttctaattttttgaacgctaaggttaaaaaagagttttgtaagattaatgaa
atttctttaaagaatcttgataaagcgtataaaatatttaaaggactcaataaaaacaaa
aatggcaatgttgacttattagaaaaaatttttagtaaatcatttgactataatttgtca
gttagagaacaagatggttcttataaacatgtcgcatcgggtagaaaattatatattcat
cctacaagtaatttttttaagaaaaatattaaaaaaatagtatttgtagatgttttatgt
accactaaagaatacgttagaattgtaggtaaatatttataa

DBGET integrated database retrieval system