KEGG   Nosema ceranae: NCER_100966Help
Entry
NCER_100966       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
  KO
K10739  replication factor A2
Organism
nce  Nosema ceranae
Pathway
nce03030  DNA replication
nce03420  Nucleotide excision repair
nce03430  Mismatch repair
nce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCER_100966
   03420 Nucleotide excision repair
    NCER_100966
   03430 Mismatch repair
    NCER_100966
   03440 Homologous recombination
    NCER_100966
DNA replication proteins [BR:nce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    NCER_100966
DNA repair and recombination proteins [BR:nce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     NCER_100966
   MMR (mismatch exicision repair)
     NCER_100966
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     NCER_100966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon RPA_C CARD tRNA_anti_2
Motif
Other DBs
NCBI-ProteinID: EEQ82336
UniProt: C4V8W6
AA seq 218 aa AA seqDB search
MSDLGYNPSSPKKEYTGIKTIRSLTIKQVLSAEHEDGSTVIYVDNKELSTLKIIGWVYSV
KSTNSGKTFIVEDGTGEIECMLWANRAYEEYMASFIEDGILVRIVGTLKEFLGKKNITVS
NIYVVEDYNELLYHMITAVKDHLSKKEILNKEDMHKIHRDILECIRNNQDDDTGLDIKII
IKCLQNEYNERMIRESLEYLVDNCHLVITNDDGYKTVN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatctcggttataatccttcatcacctaaaaaagaatacactggtataaaaact
ataagatctcttacaatcaaacaagtattatctgccgaacacgaagatggttctacagta
atctatgtagacaataaagaacttagtacactaaaaattattggatgggtgtacagtgta
aaaagtactaacagtggtaaaacttttattgttgaagacggaactggagaaattgaatgc
atgttatgggctaatagggcctatgaagaatatatggccagttttattgaggatggaata
ctggtcagaattgtaggcacacttaaagaatttttgggaaaaaaaaatattactgtttct
aacatttatgttgtagaagattacaatgaattattgtatcacatgattactgcagtaaaa
gatcatttatctaaaaaagaaatattaaataaagaagatatgcataaaatacacagagat
atattagaatgtataaggaacaatcaagatgatgacactggtttagatataaaaattatt
attaaatgtttacaaaatgaatacaacgagagaatgataagagaaagtttagaatatttg
gtagataattgtcatctagttattacaaatgatgatggatataaaactgttaattaa

DBGET integrated database retrieval system